Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chicken PQ-loop repeat-containing protein 2 (PQLC2)

This Recombinant Chicken PQ-loop repeat-containing protein 2 (PQLC2) spans the amino acid sequence from region 1-303.

Product Specifications

Product Name Alternative

PQ-loop repeat-containing protein 2

UniProt

Q5ZJX0

Expression Region

1-303

Origin

Gallus gallus (Chicken)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAEGLRAPPPPGNGSECPDGARWVLRLLGECARDGRDVGSALLGLLSIGCFAAAALPQFY QACKTGIMDRALSIYFLLGWLGGDLLNLIGSFLANQLPLQVYTAVYYVLADLVMLSLYGY YKAKNWGTGATASINAACLFCLLGTATTLTVLSHDTGPAPNPAAFGGRSLLSLGLEGPGP EPISKTEIIGFAIGSISSVLYLCSRLPQIYTNYRRKSTAGVSFLLFALVMLGNLLYGTSV LLKNPEPGQSEGDYILHHLPWLIGSLGVLSLDVIISFQFLAYRTGQPSAGEEREALLAEH GDS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CTGLF10P Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV759392 1.0 µg DNA

CTGLF10P Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details
TTC8 (NM_001288783) Human Tagged ORF Clone
RC237101 10 µg

TTC8 (NM_001288783) Human Tagged ORF Clone

Sign In for Pricing
View Details
Human Coiled coil domain containing protein 102A (CCDC102A) ELISA kit
GTR10460520 96 Well

Human Coiled coil domain containing protein 102A (CCDC102A) ELISA kit

Sign In for Pricing
View Details
CIDEB Antibody
E19-3608 100 µg -100 µL

CIDEB Antibody

Sign In for Pricing
View Details
S1PR2 CRISPR All-in-one AAV vector set (with saCas9)(Rat)
42955156 3x 1.0 µg DNA

S1PR2 CRISPR All-in-one AAV vector set (with saCas9)(Rat)

Sign In for Pricing
View Details
Iqcf3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)
K6605107 1.0 µg DNA

Iqcf3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details