Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chicken PQ-loop repeat-containing protein 2 (PQLC2)

This Recombinant Chicken PQ-loop repeat-containing protein 2 (PQLC2) spans the amino acid sequence from region 1-303.

Product Specifications

Product Name Alternative

PQ-loop repeat-containing protein 2

UniProt

Q5ZJX0

Expression Region

1-303

Origin

Gallus gallus (Chicken)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAEGLRAPPPPGNGSECPDGARWVLRLLGECARDGRDVGSALLGLLSIGCFAAAALPQFY QACKTGIMDRALSIYFLLGWLGGDLLNLIGSFLANQLPLQVYTAVYYVLADLVMLSLYGY YKAKNWGTGATASINAACLFCLLGTATTLTVLSHDTGPAPNPAAFGGRSLLSLGLEGPGP EPISKTEIIGFAIGSISSVLYLCSRLPQIYTNYRRKSTAGVSFLLFALVMLGNLLYGTSV LLKNPEPGQSEGDYILHHLPWLIGSLGVLSLDVIISFQFLAYRTGQPSAGEEREALLAEH GDS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RXRA Antibody Blocking Peptide
orb1507236 500 µg

RXRA Antibody Blocking Peptide

Sign In for Pricing
View Details
Mouse anti ganglioside (GM1) antibody (IgG) ELISA kit
GTR10431854 96 Well

Mouse anti ganglioside (GM1) antibody (IgG) ELISA kit

Sign In for Pricing
View Details
IFITM10 CytoSection
TS429563P5 25 Slides

IFITM10 CytoSection

Sign In for Pricing
View Details
4- (Butane-1-sulfonamido) benzoic acid
KJB69587-01 250 mg

4- (Butane-1-sulfonamido) benzoic acid

Sign In for Pricing
View Details
4- (Butane-1-sulfonamido) benzoic acid
KJB69587-02 2.5 g

4- (Butane-1-sulfonamido) benzoic acid

Sign In for Pricing
View Details
CRYBA2 (NM_005209) Human Recombinant Protein
TP316085M 100 µg

CRYBA2 (NM_005209) Human Recombinant Protein

Sign In for Pricing
View Details