Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pan paniscus Taste receptor type 2 member 13 (TAS2R13)

This Recombinant Pan paniscus Taste receptor type 2 member 13 (TAS2R13) spans the amino acid sequence from region 1-303.

Product Specifications

Product Name Alternative

Taste receptor type 2 member 13, T2R13

UniProt

Q646D8

Expression Region

1-303

Origin

Pan paniscus (Pygmy chimpanzee) (Bonobo)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MESALPSIFTLVIIAEFIIGNLSNGFIVLINCIDWVSKRELSSVDKLLIILAISRIGLIW EILVSWFLALHSLAIFVSGTGLRIMIFSWIVSNHFNLWLATILSIFYLLKIASFSSPAFL YLKRRVNKVILMILLGTLVFLFLNLIQINMLIKDWLDRYERNTTWNFSMSDFETFSVSVR FTMTMFSLTPFTVAFISFLLLVFSLQKHLQKMQLNYKGHRDPRTKVHTNALKIVISFLLF YASFFLSILISWISELYQNTVIYMLCETIGAFYPSSHSFLLILGNAKLRQAFLLVAAKVW AKR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rb (RB1) Mouse Monoclonal Antibody [Clone ID: OTI3F11]
CF805656 100 µg

Rb (RB1) Mouse Monoclonal Antibody [Clone ID: OTI3F11]

Sign In for Pricing
View Details
Human ZNF512B activation kit by CRISPRa
GA111518 1 Kit

Human ZNF512B activation kit by CRISPRa

Sign In for Pricing
View Details
Frozen Tissue Sections, Duodenum
CS505246 5x 5 µm

Frozen Tissue Sections, Duodenum

Sign In for Pricing
View Details
Recombinant Human PAFAH1B2/PAFAHB Protein (His Tag)
PKSH032847-01 10 µg

Recombinant Human PAFAH1B2/PAFAHB Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human PAFAH1B2/PAFAHB Protein (His Tag)
PKSH032847-02 50 µg

Recombinant Human PAFAH1B2/PAFAHB Protein (His Tag)

Sign In for Pricing
View Details
CD21 (Mature B-Cell & Follicular Dendritic Cell Marker) (CR2/1953), 0.2mg/mL
BNUB1953-500 1x 500 µL

CD21 (Mature B-Cell & Follicular Dendritic Cell Marker) (CR2/1953), 0.2mg/mL

Sign In for Pricing
View Details