Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pan paniscus Taste receptor type 2 member 13 (TAS2R13)

This Recombinant Pan paniscus Taste receptor type 2 member 13 (TAS2R13) spans the amino acid sequence from region 1-303.

Product Specifications

Product Name Alternative

Taste receptor type 2 member 13, T2R13

UniProt

Q646D8

Expression Region

1-303

Origin

Pan paniscus (Pygmy chimpanzee) (Bonobo)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MESALPSIFTLVIIAEFIIGNLSNGFIVLINCIDWVSKRELSSVDKLLIILAISRIGLIW EILVSWFLALHSLAIFVSGTGLRIMIFSWIVSNHFNLWLATILSIFYLLKIASFSSPAFL YLKRRVNKVILMILLGTLVFLFLNLIQINMLIKDWLDRYERNTTWNFSMSDFETFSVSVR FTMTMFSLTPFTVAFISFLLLVFSLQKHLQKMQLNYKGHRDPRTKVHTNALKIVISFLLF YASFFLSILISWISELYQNTVIYMLCETIGAFYPSSHSFLLILGNAKLRQAFLLVAAKVW AKR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Brcc3 Mouse Gene Knockout Kit (CRISPR)
KN502250 1 Kit

Brcc3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
DOG-1 / TMEM16A (Gastrointestinal Stromal Tumor Marker) (DG1/2564R), 0.2mg/mL
BNUB2564-100 1x 100 µL

DOG-1 / TMEM16A (Gastrointestinal Stromal Tumor Marker) (DG1/2564R), 0.2mg/mL

Sign In for Pricing
View Details
TREM1 Polyclonal Antibody
E-AB-90012-01 60 µL

TREM1 Polyclonal Antibody

Sign In for Pricing
View Details
TREM1 Polyclonal Antibody
E-AB-90012-02 120 µL

TREM1 Polyclonal Antibody

Sign In for Pricing
View Details
TREM1 Polyclonal Antibody
E-AB-90012-03 200 µL

TREM1 Polyclonal Antibody

Sign In for Pricing
View Details
Rhodamine B
TRC-R318605-500G 500 g

Rhodamine B

Sign In for Pricing
View Details