Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pan paniscus Taste receptor type 2 member 13 (TAS2R13)

This Recombinant Pan paniscus Taste receptor type 2 member 13 (TAS2R13) spans the amino acid sequence from region 1-303.

Product Specifications

Product Name Alternative

Taste receptor type 2 member 13, T2R13

UniProt

Q646D8

Expression Region

1-303

Origin

Pan paniscus (Pygmy chimpanzee) (Bonobo)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MESALPSIFTLVIIAEFIIGNLSNGFIVLINCIDWVSKRELSSVDKLLIILAISRIGLIW EILVSWFLALHSLAIFVSGTGLRIMIFSWIVSNHFNLWLATILSIFYLLKIASFSSPAFL YLKRRVNKVILMILLGTLVFLFLNLIQINMLIKDWLDRYERNTTWNFSMSDFETFSVSVR FTMTMFSLTPFTVAFISFLLLVFSLQKHLQKMQLNYKGHRDPRTKVHTNALKIVISFLLF YASFFLSILISWISELYQNTVIYMLCETIGAFYPSSHSFLLILGNAKLRQAFLLVAAKVW AKR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Basic Xylanase Microplate Assay Kit
RDSM091 100 Assays

Basic Xylanase Microplate Assay Kit

Sign In for Pricing
View Details
TAF1 48 (TAF1A) (NM_005681) Human Over-expression Lysate
LC401732 20 µg

TAF1 48 (TAF1A) (NM_005681) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant RIP Monoclonal Antibody
AN301086L-01 50 µL

Recombinant RIP Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant RIP Monoclonal Antibody
AN301086L-02 100 µL

Recombinant RIP Monoclonal Antibody

Sign In for Pricing
View Details
FMOC-Lys (TQ3) -OH
5258-AAT 100 mg

FMOC-Lys (TQ3) -OH

Sign In for Pricing
View Details
RSK1 p90 (RPS6KA1) Rabbit Polyclonal Antibody
AP02663PU-S 50 µL

RSK1 p90 (RPS6KA1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details