Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Heme A synthase (ctaA)

This Recombinant Staphylococcus aureus Heme A synthase (ctaA) spans the amino acid sequence from region 1-303.

Product Specifications

Product Name Alternative

Heme A synthase, HAS, EC= 1.3.-.-, Cytochrome aa3-controlling protein

UniProt

Q7A665

Expression Region

1-303

Origin

Staphylococcus aureus (strain N315)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFGKKNLKWLGVVATLMMTFVQLGGALVTKTGSADGCGSSWPLCHGALIPEFFPIDTIIE LSHRAVSALSLLMVLWLVITAWKHIGYIKEIKPLSIISVGFLLLQALIGAAAVIWQQNDY VLALHFGISLISFSSVFLITLIIFSIDQKYEADELYIKKPLRRLTWLMAIIIYCGVYTGA LVRHADASLAYGGWPLPFHDLVPHSEQDWVQLTHRIMAFIVFTIIMITYIHAVKNYPNNR TVHYGYTAAFILVILQVITGALSIMTNVNLIIALFHALFITYLFGMTTYFIMLMLRSVRS DKQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sialomucin core protein 24 (CD164) Rat ELISA Kit
H0754 96 Tests

Sialomucin core protein 24 (CD164) Rat ELISA Kit

Sign In for Pricing
View Details
Rabbit Rad50 Antibody
orb1530576-01 10 µL

Rabbit Rad50 Antibody

Sign In for Pricing
View Details
Rabbit Rad50 Antibody
orb1530576-02 100 µL

Rabbit Rad50 Antibody

Sign In for Pricing
View Details
(R)-α-Amino-1,4-cyclohexadiene-1-acetic acid
abx181459-01 5 g

(R)-α-Amino-1,4-cyclohexadiene-1-acetic acid

Sign In for Pricing
View Details
(R)-α-Amino-1,4-cyclohexadiene-1-acetic acid
abx181459-02 25 g

(R)-α-Amino-1,4-cyclohexadiene-1-acetic acid

Sign In for Pricing
View Details
(R)-α-Amino-1,4-cyclohexadiene-1-acetic acid
abx181459-03 50 g

(R)-α-Amino-1,4-cyclohexadiene-1-acetic acid

Sign In for Pricing
View Details