Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Heme A synthase (ctaA)

This Recombinant Staphylococcus aureus Heme A synthase (ctaA) spans the amino acid sequence from region 1-303.

Product Specifications

Product Name Alternative

Heme A synthase, HAS, EC= 1.3.-.-, Cytochrome aa3-controlling protein

UniProt

Q7A665

Expression Region

1-303

Origin

Staphylococcus aureus (strain N315)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFGKKNLKWLGVVATLMMTFVQLGGALVTKTGSADGCGSSWPLCHGALIPEFFPIDTIIE LSHRAVSALSLLMVLWLVITAWKHIGYIKEIKPLSIISVGFLLLQALIGAAAVIWQQNDY VLALHFGISLISFSSVFLITLIIFSIDQKYEADELYIKKPLRRLTWLMAIIIYCGVYTGA LVRHADASLAYGGWPLPFHDLVPHSEQDWVQLTHRIMAFIVFTIIMITYIHAVKNYPNNR TVHYGYTAAFILVILQVITGALSIMTNVNLIIALFHALFITYLFGMTTYFIMLMLRSVRS DKQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pacc1 Mouse qPCR Primer Pair (NM_025864)
MP217436 200 Reactions

Pacc1 Mouse qPCR Primer Pair (NM_025864)

Sign In for Pricing
View Details
AKAP9 Knockout HGC-27 Polyclonal Cells
ARG29476 1 Million

AKAP9 Knockout HGC-27 Polyclonal Cells

Sign In for Pricing
View Details
Recombinant Escherichia coli Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase (lpxA)
MBS1251706-01 0.02 mg (E-Coli)

Recombinant Escherichia coli Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase (lpxA)

Sign In for Pricing
View Details
Recombinant Escherichia coli Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase (lpxA)
MBS1251706-02 0.02 mg (Yeast)

Recombinant Escherichia coli Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase (lpxA)

Sign In for Pricing
View Details
Recombinant Escherichia coli Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase (lpxA)
MBS1251706-03 0.1 mg (E-Coli)

Recombinant Escherichia coli Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase (lpxA)

Sign In for Pricing
View Details
Recombinant Escherichia coli Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase (lpxA)
MBS1251706-04 0.1 mg (Yeast)

Recombinant Escherichia coli Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase (lpxA)

Sign In for Pricing
View Details