Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Heme A synthase (ctaA)

This Recombinant Staphylococcus aureus Heme A synthase (ctaA) spans the amino acid sequence from region 1-303.

Product Specifications

Product Name Alternative

Heme A synthase, HAS, EC= 1.3.-.-, Cytochrome aa3-controlling protein

UniProt

Q6GA99

Expression Region

1-303

Origin

Staphylococcus aureus (strain MSSA476)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFGKKNLKWLGVVATLMMTFVQLGGALVTKTGSADGCGSSWPLCHGALIPEFFPIDTIIE LSHRAVSALSLLMVLWLVITAWKHIGYIKEIKPLSIISVGFLLLQALIGAAAVIWQQNDY VLALHFGISLISFSSVFLITLIIFSIDQKYEADELYIKKPLRRLTWLMAIIIYCGVYTGA LVRHADASLAYGGWPLPFHDLVPHSEQDWVQLTHRIMAFIVFTIIMITYIHAVKNYPNNR TVHYGYTAAFILVILQVITGALSIMTNVNLLIALFHALFITYLFGMTTYFIMLMLRSVRS DKQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Drosophila madeirensis NADH-ubiquinone oxidoreductase chain 1 (mt:ND1)
orb2920387-01 20 µg

Recombinant Drosophila madeirensis NADH-ubiquinone oxidoreductase chain 1 (mt:ND1)

Sign In for Pricing
View Details
Recombinant Drosophila madeirensis NADH-ubiquinone oxidoreductase chain 1 (mt:ND1)
orb2920387-02 100 µg

Recombinant Drosophila madeirensis NADH-ubiquinone oxidoreductase chain 1 (mt:ND1)

Sign In for Pricing
View Details
Human Prostaglandin E (PGE) ELISA Kit
orb2810326-01 48 Tests

Human Prostaglandin E (PGE) ELISA Kit

Sign In for Pricing
View Details
Human Prostaglandin E (PGE) ELISA Kit
orb2810326-02 96 Tests

Human Prostaglandin E (PGE) ELISA Kit

Sign In for Pricing
View Details
Human Prostaglandin E (PGE) ELISA Kit
orb2810326-03 5 x 96 T

Human Prostaglandin E (PGE) ELISA Kit

Sign In for Pricing
View Details
Anti-Nitric Oxide Synthase, Pan (bNOS, iNOS, eNOS, NOS I-III)
MBS633263-01 0.1 mL

Anti-Nitric Oxide Synthase, Pan (bNOS, iNOS, eNOS, NOS I-III)

Sign In for Pricing
View Details