Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Heme A synthase (ctaA)

This Recombinant Staphylococcus aureus Heme A synthase (ctaA) spans the amino acid sequence from region 1-303.

Product Specifications

Product Name Alternative

Heme A synthase, HAS, EC= 1.3.-.-, Cytochrome aa3-controlling protein

UniProt

Q7A2S8

Expression Region

1-303

Origin

Staphylococcus aureus (strain Mu50 / ATCC 700699)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFGKKNLKWLGVVATLMMTFVQLGGALVTKTGSADGCGSSWPLCHGALIPEFFPIDTIIE LSHRAVSALSLLMVLWLVITAWKHIGYIKEIKPLSIISVGFLLLQALIGAAAVIWQQNDY VLALHFGISLISFSSVFLITLIIFSIDQKYEADELYIKKPLRRLTWLMAIIIYCGVYTGA LVRHADASLAYGGWPLPFHDLVPHSEQDWVQLTHRIMAFIVFTIIMITYIHAVKNYPNNR TVHYGYTAAFILVILQVITGALSIMTNVNLIIALFHALFITYLFGMTTYFIMLMLRSVRS DKQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

S-β- (4-Pyridylethyl) -L-cysteine
TXB-00159-01 1 g

S-β- (4-Pyridylethyl) -L-cysteine

Sign In for Pricing
View Details
S-β- (4-Pyridylethyl) -L-cysteine
TXB-00159-02 250 mg

S-β- (4-Pyridylethyl) -L-cysteine

Sign In for Pricing
View Details
S-β- (4-Pyridylethyl) -L-cysteine
TXB-00159-03 5 g

S-β- (4-Pyridylethyl) -L-cysteine

Sign In for Pricing
View Details
Anti-Chk2 Rabbit Monoclonal Antibody
MA1915-.1 100 µL

Anti-Chk2 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Chicken GPX3 (Glutathione peroxidase 3) ELISA Kit
orb1714986-01 48 Tests

Chicken GPX3 (Glutathione peroxidase 3) ELISA Kit

Sign In for Pricing
View Details
Chicken GPX3 (Glutathione peroxidase 3) ELISA Kit
orb1714986-02 96 Tests

Chicken GPX3 (Glutathione peroxidase 3) ELISA Kit

Sign In for Pricing
View Details