Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Heme A synthase (ctaA)

This Recombinant Staphylococcus aureus Heme A synthase (ctaA) spans the amino acid sequence from region 1-303.

Product Specifications

Product Name Alternative

Heme A synthase, HAS, EC= 1.3.-.-, Cytochrome aa3-controlling protein

UniProt

Q7A160

Expression Region

1-303

Origin

Staphylococcus aureus (strain MW2)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFGKKNLKWLGVVATLMMTFVQLGGALVTKTGSADGCGSSWPLCHGALIPEFFPIDTIIE LSHRAVSALSLLMVLWLVITAWKHIGYIKEIKPLSIISVGFLLLQALIGAAAVIWQQNDY VLALHFGISLISFSSVFLITLIIFSIDQKYEADELYIKKPLRRLTWLMAIIIYCGVYTGA LVRHADASLAYGGWPLPFHDLVPHSEQDWVQLTHRIMAFIVFTIIMITYIHAVKNYPNNR TVHYGYTAAFILVILQVITGALSIMTNVNLIIALFHALFITYLFGMTTYFIMLMLRSVRS DKQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLC44A4 (ASG-5ME) discontinued
047809 100 µg

SLC44A4 (ASG-5ME) discontinued

Sign In for Pricing
View Details
Bovine Activating Transcription Factor 1 ELISA Kit
OM620419 96 Strip Well

Bovine Activating Transcription Factor 1 ELISA Kit

Sign In for Pricing
View Details
Cytochrome P450 2D6 Colorimetric Cell-Based ELISA Kit
MBS9500946-01 1 Kit

Cytochrome P450 2D6 Colorimetric Cell-Based ELISA Kit

Sign In for Pricing
View Details
Cytochrome P450 2D6 Colorimetric Cell-Based ELISA Kit
MBS9500946-02 5x 1 Kit

Cytochrome P450 2D6 Colorimetric Cell-Based ELISA Kit

Sign In for Pricing
View Details
Hamster V-Type Proton ATPase Subunit D2 (ATP6V0D2) ELISA Kit
MBS9395247-01 48 Well

Hamster V-Type Proton ATPase Subunit D2 (ATP6V0D2) ELISA Kit

Sign In for Pricing
View Details
Hamster V-Type Proton ATPase Subunit D2 (ATP6V0D2) ELISA Kit
MBS9395247-02 96 Well

Hamster V-Type Proton ATPase Subunit D2 (ATP6V0D2) ELISA Kit

Sign In for Pricing
View Details