Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Heme A synthase (ctaA)

This Recombinant Staphylococcus aureus Heme A synthase (ctaA) spans the amino acid sequence from region 1-303.

Product Specifications

Product Name Alternative

Heme A synthase, HAS, EC= 1.3.-.-, Cytochrome aa3-controlling protein

UniProt

Q7A160

Expression Region

1-303

Origin

Staphylococcus aureus (strain MW2)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFGKKNLKWLGVVATLMMTFVQLGGALVTKTGSADGCGSSWPLCHGALIPEFFPIDTIIE LSHRAVSALSLLMVLWLVITAWKHIGYIKEIKPLSIISVGFLLLQALIGAAAVIWQQNDY VLALHFGISLISFSSVFLITLIIFSIDQKYEADELYIKKPLRRLTWLMAIIIYCGVYTGA LVRHADASLAYGGWPLPFHDLVPHSEQDWVQLTHRIMAFIVFTIIMITYIHAVKNYPNNR TVHYGYTAAFILVILQVITGALSIMTNVNLIIALFHALFITYLFGMTTYFIMLMLRSVRS DKQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD53 Rabbit Monoclonal Antibody
AMRe87172-01 1 Each

CD53 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
CD53 Rabbit Monoclonal Antibody
AMRe87172-02 50 µL

CD53 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
CD53 Rabbit Monoclonal Antibody
AMRe87172-03 100 µL

CD53 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
NAGK (N-Acetylglucosamine Kinase, N-acetyl-D-glucosamine Kinase, GlcNAc Kinase, GNK, HSA242910) (MaxLight 750) discontinued
130125-ML750 100 µL

NAGK (N-Acetylglucosamine Kinase, N-acetyl-D-glucosamine Kinase, GlcNAc Kinase, GNK, HSA242910) (MaxLight 750) discontinued

Sign In for Pricing
View Details
DOTA (OtBu) ₃
4029066.0250 250 mg

DOTA (OtBu) ₃

Sign In for Pricing
View Details
PCDHB1, CT (PCDHB1, Protocadherin beta-1) (MaxLight 550) discontinued
039740-ML550 100 µL

PCDHB1, CT (PCDHB1, Protocadherin beta-1) (MaxLight 550) discontinued

Sign In for Pricing
View Details