Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Heme A synthase (ctaA)

This Recombinant Staphylococcus aureus Heme A synthase (ctaA) spans the amino acid sequence from region 1-303.

Product Specifications

Product Name Alternative

Heme A synthase, HAS, EC= 1.3.-.-, Cytochrome aa3-controlling protein

UniProt

Q7A160

Expression Region

1-303

Origin

Staphylococcus aureus (strain MW2)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFGKKNLKWLGVVATLMMTFVQLGGALVTKTGSADGCGSSWPLCHGALIPEFFPIDTIIE LSHRAVSALSLLMVLWLVITAWKHIGYIKEIKPLSIISVGFLLLQALIGAAAVIWQQNDY VLALHFGISLISFSSVFLITLIIFSIDQKYEADELYIKKPLRRLTWLMAIIIYCGVYTGA LVRHADASLAYGGWPLPFHDLVPHSEQDWVQLTHRIMAFIVFTIIMITYIHAVKNYPNNR TVHYGYTAAFILVILQVITGALSIMTNVNLIIALFHALFITYLFGMTTYFIMLMLRSVRS DKQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DSCR1L1, NT (RCAN2, DSCR1L1, ZAKI4, Calcipressin-2, Down syndrome candidate region 1-like 1, Myocyte-enriched calcineurin-interacting protein 2, Regulator of calcineurin 2, Thyroid hormone-responsive protein ZAKI-4) (Biotin)
MBS6293556-01 0.2 mL

DSCR1L1, NT (RCAN2, DSCR1L1, ZAKI4, Calcipressin-2, Down syndrome candidate region 1-like 1, Myocyte-enriched calcineurin-interacting protein 2, Regulator of calcineurin 2, Thyroid hormone-responsive protein ZAKI-4) (Biotin)

Sign In for Pricing
View Details
DSCR1L1, NT (RCAN2, DSCR1L1, ZAKI4, Calcipressin-2, Down syndrome candidate region 1-like 1, Myocyte-enriched calcineurin-interacting protein 2, Regulator of calcineurin 2, Thyroid hormone-responsive protein ZAKI-4) (Biotin)
MBS6293556-02 5x 0.2 mL

DSCR1L1, NT (RCAN2, DSCR1L1, ZAKI4, Calcipressin-2, Down syndrome candidate region 1-like 1, Myocyte-enriched calcineurin-interacting protein 2, Regulator of calcineurin 2, Thyroid hormone-responsive protein ZAKI-4) (Biotin)

Sign In for Pricing
View Details
DBC 1 Mouse mAb
orb2716968-01 50 µL

DBC 1 Mouse mAb

Sign In for Pricing
View Details
DBC 1 Mouse mAb
orb2716968-02 100 µL

DBC 1 Mouse mAb

Sign In for Pricing
View Details
EI24 Protein Vector (Mouse) (pPM-C-HA)
PV174892 500 ng

EI24 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Lentiviral mouse Traf1 shRNA (UAS) - Lentiviral mouse Traf1 shRNA (UAS) (25)
GTR15271997 1 Vial

Lentiviral mouse Traf1 shRNA (UAS) - Lentiviral mouse Traf1 shRNA (UAS) (25)

Sign In for Pricing
View Details