Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus Prolipoprotein diacylglyceryl transferase (lgt)

This Recombinant Prochlorococcus marinus Prolipoprotein diacylglyceryl transferase (lgt) spans the amino acid sequence from region 1-303.

Product Specifications

Product Name Alternative

Prolipoprotein diacylglyceryl transferase, EC= 2.4.99.-

UniProt

Q7VDC2

Expression Region

1-303

Origin

Prochlorococcus marinus (strain SARG / CCMP1375 / SS120)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEGIIATFRSPGAELIELGTLTVRWYGILIAISVLIGLKLSTRLGSYRNINPGIINDLMP ILILSSIFGARFYYVSFEWNNYNGVNFWSKVHLLGLQIPIPSFLEIWNGGIAIHGALIMG TISIILFCRIKKQRFWDVLDVLVPSVALGQAIGRWGNFFNNEAFGLPTNQPWKLFIPFSS RPESFSDQSYFHPTFLYESLWNICIFLILIFLFRLNIRGLMKLPSGALSCIYLITYSLGR IWIEGLRIDPLCLGGSPPFCEGGLRIAQLISFLLICLGSFGLWWIYQSKRKMPNFGITRN RKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Integrin beta 1 (ITGB1) Mouse Monoclonal Antibody [Clone ID: k2D5]
AM09002PU-S 50 µL

Integrin beta 1 (ITGB1) Mouse Monoclonal Antibody [Clone ID: k2D5]

Sign In for Pricing
View Details
Csrp2 (NM_007792) Mouse Tagged ORF Clone
MG201864 10 µg

Csrp2 (NM_007792) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Recombinant Mouse Ager Protein (His Tag)
PDMM100050-01 20 µg

Recombinant Mouse Ager Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Mouse Ager Protein (His Tag)
PDMM100050-02 100 µg

Recombinant Mouse Ager Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Mouse Ager Protein (His Tag)
PDMM100050-03 500 µg

Recombinant Mouse Ager Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Mouse Ager Protein (His Tag)
PDMM100050-04 1 mg

Recombinant Mouse Ager Protein (His Tag)

Sign In for Pricing
View Details