Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus Prolipoprotein diacylglyceryl transferase (lgt)

This Recombinant Prochlorococcus marinus Prolipoprotein diacylglyceryl transferase (lgt) spans the amino acid sequence from region 1-303.

Product Specifications

Product Name Alternative

Prolipoprotein diacylglyceryl transferase, EC= 2.4.99.-

UniProt

Q7VDC2

Expression Region

1-303

Origin

Prochlorococcus marinus (strain SARG / CCMP1375 / SS120)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEGIIATFRSPGAELIELGTLTVRWYGILIAISVLIGLKLSTRLGSYRNINPGIINDLMP ILILSSIFGARFYYVSFEWNNYNGVNFWSKVHLLGLQIPIPSFLEIWNGGIAIHGALIMG TISIILFCRIKKQRFWDVLDVLVPSVALGQAIGRWGNFFNNEAFGLPTNQPWKLFIPFSS RPESFSDQSYFHPTFLYESLWNICIFLILIFLFRLNIRGLMKLPSGALSCIYLITYSLGR IWIEGLRIDPLCLGGSPPFCEGGLRIAQLISFLLICLGSFGLWWIYQSKRKMPNFGITRN RKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Melanoma Marker (HMB45 + M2-7C10 + M2-9E3 + T311), CF568 conjugate, 0.1mg/mL
BNC680701-500 1x 500 µL

Melanoma Marker (HMB45 + M2-7C10 + M2-9E3 + T311), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SLC12A6 (NM_001042494) Human Over-expression Lysate
LC420941 20 µg

SLC12A6 (NM_001042494) Human Over-expression Lysate

Sign In for Pricing
View Details
Tissue Genomic DNA, Colon: right
CD564145 5 µg

Tissue Genomic DNA, Colon: right

Sign In for Pricing
View Details
Epsilon Dipeptide
TRC-E592296-250MG 250 mg

Epsilon Dipeptide

Sign In for Pricing
View Details
(+)-ar-Turmerone
TRC-T897275-1MG 1 mg

(+)-ar-Turmerone

Sign In for Pricing
View Details
VASP (Ab-238) Antibody
8B7250-AAT 50 µg

VASP (Ab-238) Antibody

Sign In for Pricing
View Details