Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus Prolipoprotein diacylglyceryl transferase (lgt)

This Recombinant Prochlorococcus marinus Prolipoprotein diacylglyceryl transferase (lgt) spans the amino acid sequence from region 1-304.

Product Specifications

Product Name Alternative

Prolipoprotein diacylglyceryl transferase, EC= 2.4.99.-

UniProt

A2C7F4

Expression Region

1-304

Origin

Prochlorococcus marinus (strain MIT 9303)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDAFIATFTSPGPELFQLGPFALRWYGLLIAIAVLIGLNLSSSLARKRGLEQGLISDLLP ILVLTAVVGARIYYVAFEWRNYSGDNFWSSINIFGLAIPIPSAMEIWGGGIAIHGALLSG TLAVLIFCRWRRQAFWDVLDVLVPSIALGQAIGRWGNFFNNEAFGVPIKGDLAWKLFIPF VNRPLNYANNEFFHPTFLYESIWNLLVFTLLIVLFQRSNKGLLKLPAGALSCIYLITYSL GRVWIEALRTDPLCLGALPPSCEGGLRIAQLMSLAMMAVGGFGLWWLYGRKRKLPDPGRP KSFA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

6230409E13Rik (BC059864) Mouse Untagged Clone
MC206959 10 µg

6230409E13Rik (BC059864) Mouse Untagged Clone

Sign In for Pricing
View Details
Human LETM2 (NM_144652) AAV Particle
RC215607A1V 250 µL

Human LETM2 (NM_144652) AAV Particle

Sign In for Pricing
View Details
Zinc Finger Protein 28 (ZFP28) Antibody
abx036686-01 100 µg

Zinc Finger Protein 28 (ZFP28) Antibody

Sign In for Pricing
View Details
Zinc Finger Protein 28 (ZFP28) Antibody
abx036686-02 1 mg

Zinc Finger Protein 28 (ZFP28) Antibody

Sign In for Pricing
View Details
Goat Contagious Pustular Dermatitis Virus Antibody IgG (CPDV-IgG) ELISA Kit
NSL1424Gt 96 Tests

Goat Contagious Pustular Dermatitis Virus Antibody IgG (CPDV-IgG) ELISA Kit

Sign In for Pricing
View Details
SPRR2G Protein Vector (Human) (pPM-C-His)
PV133241 500 ng

SPRR2G Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details