Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus Prolipoprotein diacylglyceryl transferase (lgt)

This Recombinant Prochlorococcus marinus Prolipoprotein diacylglyceryl transferase (lgt) spans the amino acid sequence from region 1-304.

Product Specifications

Product Name Alternative

Prolipoprotein diacylglyceryl transferase, EC= 2.4.99.-

UniProt

A2C7F4

Expression Region

1-304

Origin

Prochlorococcus marinus (strain MIT 9303)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDAFIATFTSPGPELFQLGPFALRWYGLLIAIAVLIGLNLSSSLARKRGLEQGLISDLLP ILVLTAVVGARIYYVAFEWRNYSGDNFWSSINIFGLAIPIPSAMEIWGGGIAIHGALLSG TLAVLIFCRWRRQAFWDVLDVLVPSIALGQAIGRWGNFFNNEAFGVPIKGDLAWKLFIPF VNRPLNYANNEFFHPTFLYESIWNLLVFTLLIVLFQRSNKGLLKLPAGALSCIYLITYSL GRVWIEALRTDPLCLGALPPSCEGGLRIAQLMSLAMMAVGGFGLWWLYGRKRKLPDPGRP KSFA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal MED4 Antibody [Janelia Fluor 646]
NBP2-99047JF646 0.1 mL

Rabbit Polyclonal MED4 Antibody [Janelia Fluor 646]

Sign In for Pricing
View Details
POLR1B (NM_019014) Human Over-expression Lysate
E45H17799-2 20 µg

POLR1B (NM_019014) Human Over-expression Lysate

Sign In for Pricing
View Details
Goat IgG (H&L) Secondary Antibody Peroxidase Conjugated
orb346990 2 mg

Goat IgG (H&L) Secondary Antibody Peroxidase Conjugated

Sign In for Pricing
View Details
Mouse Uromodulin (UMOD) ELISA Kit
DL-UMOD-Mu-01 48 Tests

Mouse Uromodulin (UMOD) ELISA Kit

Sign In for Pricing
View Details
Mouse Uromodulin (UMOD) ELISA Kit
DL-UMOD-Mu-02 96 Tests

Mouse Uromodulin (UMOD) ELISA Kit

Sign In for Pricing
View Details
P63-α Mouse Monoclonal Antibody (3F11)
E44H11894 100 µL

P63-α Mouse Monoclonal Antibody (3F11)

Sign In for Pricing
View Details