Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus Prolipoprotein diacylglyceryl transferase (lgt)

This Recombinant Prochlorococcus marinus Prolipoprotein diacylglyceryl transferase (lgt) spans the amino acid sequence from region 1-304.

Product Specifications

Product Name Alternative

Prolipoprotein diacylglyceryl transferase, EC= 2.4.99.-

UniProt

Q7V652

Expression Region

1-304

Origin

Prochlorococcus marinus (strain MIT 9313)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDAFIATFTSPGPELFQLGPFALRWYGLLIAIAVLIGLNLSSSLARKRGLEQGLISDLLP ILVLTSVVGARIYYVAFEWRNYSGNNFWSSINIFGLAIPIPSAVEIWGGGIAIHGALLAG TLAVLIFCRWRRQAFWDVLDVLVPSIALGQAIGRWGNFFNNEAFGVPIKGDLAWKLFIPF VNRPLNYANNEFFHPTFLYESIWNLLVFTVLIVLFQRSSKGLLKLPAGALSCIYLITYSL GRVWIEALRTDPLCLGALPPSCEGGLRIAQLMSLAMMAVGGFGLWWLYGRKRKLPDPGRP RSFA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PON1 Rabbit pAb, Pacific Blue conjugated
orb2871273 100 µL

PON1 Rabbit pAb, Pacific Blue conjugated

Sign In for Pricing
View Details
GM130 Rabbit pAb
APA4778-01 30 µL

GM130 Rabbit pAb

Sign In for Pricing
View Details
GM130 Rabbit pAb
APA4778-02 50 μL

GM130 Rabbit pAb

Sign In for Pricing
View Details
GM130 Rabbit pAb
APA4778-03 100 µL

GM130 Rabbit pAb

Sign In for Pricing
View Details
HIP1R rabbit pAb
MBS8598076-01 0.1 mL

HIP1R rabbit pAb

Sign In for Pricing
View Details
HIP1R rabbit pAb
MBS8598076-02 0.1 mL (AF405L)

HIP1R rabbit pAb

Sign In for Pricing
View Details