Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus Prolipoprotein diacylglyceryl transferase (lgt)

This Recombinant Prochlorococcus marinus Prolipoprotein diacylglyceryl transferase (lgt) spans the amino acid sequence from region 1-304.

Product Specifications

Product Name Alternative

Prolipoprotein diacylglyceryl transferase, EC= 2.4.99.-

UniProt

Q7V652

Expression Region

1-304

Origin

Prochlorococcus marinus (strain MIT 9313)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDAFIATFTSPGPELFQLGPFALRWYGLLIAIAVLIGLNLSSSLARKRGLEQGLISDLLP ILVLTSVVGARIYYVAFEWRNYSGNNFWSSINIFGLAIPIPSAVEIWGGGIAIHGALLAG TLAVLIFCRWRRQAFWDVLDVLVPSIALGQAIGRWGNFFNNEAFGVPIKGDLAWKLFIPF VNRPLNYANNEFFHPTFLYESIWNLLVFTVLIVLFQRSSKGLLKLPAGALSCIYLITYSL GRVWIEALRTDPLCLGALPPSCEGGLRIAQLMSLAMMAVGGFGLWWLYGRKRKLPDPGRP RSFA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frizzled 6 (FZD6) Rabbit Polyclonal Antibody
TA314727 100 µL

Frizzled 6 (FZD6) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Mouse anti Human Bence Jones lambda (surface and hidden determinants), conjugated with Biotin
MBS571095-01 0.2 mg

Mouse anti Human Bence Jones lambda (surface and hidden determinants), conjugated with Biotin

Sign In for Pricing
View Details
Mouse anti Human Bence Jones lambda (surface and hidden determinants), conjugated with Biotin
MBS571095-02 5x 0.2 mg

Mouse anti Human Bence Jones lambda (surface and hidden determinants), conjugated with Biotin

Sign In for Pricing
View Details
Degarelix acetate
FD110099-01 10 mg

Degarelix acetate

Sign In for Pricing
View Details
Degarelix acetate
FD110099-02 25 mg

Degarelix acetate

Sign In for Pricing
View Details
Degarelix acetate
FD110099-03 50 mg

Degarelix acetate

Sign In for Pricing
View Details