Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 4K13 (OR4K13)

This Recombinant Human Olfactory receptor 4K13 (OR4K13) spans the amino acid sequence from region 1-304.

Product Specifications

Product Name Alternative

Olfactory receptor 4K13, Olfactory receptor OR14-27

UniProt

Q8NH42

Expression Region

1-304

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MERANHSVVSEFILLGLSKSQNLQILFFLGFSVVFVGIVLGNLLILVTVTFDSLLHTPMY FLLSNLSCIDMILASFATPKMIVDFLRERKTISWWGCYSQMFFMHLLGGSEMMLLVAMAI DRYVAICKPLHYMTIMSPRVLTGLLLSSYAVGFVHSSSQMAFMLTLPFCGPNVIDSFFCD LPLVIKLACKDTYILQLLVIADSGLLSLVCFLLLLVSYGVIIFSVRYRAASRSSKAFSTL SAHITVVTLFFAPCVFIYVWPFSRYSVDKILSVFYTIFTPLLNPIIYTLRNQEVKAAIKK RLCI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sarcomeric Actinin Alpha 2 / ACTN2 (ACTN2/3292), CF740 conjugate, 0.1mg/mL
BNC743292-100 1x 100 µL

Sarcomeric Actinin Alpha 2 / ACTN2 (ACTN2/3292), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ZNF688 Rabbit Polyclonal Antibody
TA366189 100 µL

ZNF688 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Frozen Tissue Blocks, Prostate
CB527515 1 Block

Frozen Tissue Blocks, Prostate

Sign In for Pricing
View Details
Meldrum’s Acid-13C3
TRC-M215253-25MG 25 mg

Meldrum’s Acid-13C3

Sign In for Pricing
View Details
Recombinant Mouse E-Cadherin/CDH1 Protein (His Tag)
PKSM040553 100 µg

Recombinant Mouse E-Cadherin/CDH1 Protein (His Tag)

Sign In for Pricing
View Details
RBM41 (NM_001171080) Human Over-expression Lysate
LC433013 20 µg

RBM41 (NM_001171080) Human Over-expression Lysate

Sign In for Pricing
View Details