Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 4K13 (OR4K13)

This Recombinant Human Olfactory receptor 4K13 (OR4K13) spans the amino acid sequence from region 1-304.

Product Specifications

Product Name Alternative

Olfactory receptor 4K13, Olfactory receptor OR14-27

UniProt

Q8NH42

Expression Region

1-304

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MERANHSVVSEFILLGLSKSQNLQILFFLGFSVVFVGIVLGNLLILVTVTFDSLLHTPMY FLLSNLSCIDMILASFATPKMIVDFLRERKTISWWGCYSQMFFMHLLGGSEMMLLVAMAI DRYVAICKPLHYMTIMSPRVLTGLLLSSYAVGFVHSSSQMAFMLTLPFCGPNVIDSFFCD LPLVIKLACKDTYILQLLVIADSGLLSLVCFLLLLVSYGVIIFSVRYRAASRSSKAFSTL SAHITVVTLFFAPCVFIYVWPFSRYSVDKILSVFYTIFTPLLNPIIYTLRNQEVKAAIKK RLCI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Retinol Binding Protein-1 (G4E4), CF405S conjugate, 0.1mg/mL
BNC040855-100 1x 100 µL

Retinol Binding Protein-1 (G4E4), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tenascin C (TNC) (NM_002160) Human Recombinant Protein
TP315251SE 20 µg

Tenascin C (TNC) (NM_002160) Human Recombinant Protein

Sign In for Pricing
View Details
EEF1E1 Rabbit Polyclonal Antibody
TA362186 100 µL

EEF1E1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Caspase-12 Recombinant Rabbit Monoclonal Antibody [PSH07-49]
HA722837 100 µL

Caspase-12 Recombinant Rabbit Monoclonal Antibody [PSH07-49]

Sign In for Pricing
View Details
Apg10 (ATG10) (NM_001131028) Human Recombinant Protein
TP720533 10 µg

Apg10 (ATG10) (NM_001131028) Human Recombinant Protein

Sign In for Pricing
View Details
Involucrin (IVRN/827), 0.2mg/mL
BNUB0827-100 1x 100 µL

Involucrin (IVRN/827), 0.2mg/mL

Sign In for Pricing
View Details