Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 4K13 (OR4K13)

This Recombinant Human Olfactory receptor 4K13 (OR4K13) spans the amino acid sequence from region 1-304.

Product Specifications

Product Name Alternative

Olfactory receptor 4K13, Olfactory receptor OR14-27

UniProt

Q8NH42

Expression Region

1-304

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MERANHSVVSEFILLGLSKSQNLQILFFLGFSVVFVGIVLGNLLILVTVTFDSLLHTPMY FLLSNLSCIDMILASFATPKMIVDFLRERKTISWWGCYSQMFFMHLLGGSEMMLLVAMAI DRYVAICKPLHYMTIMSPRVLTGLLLSSYAVGFVHSSSQMAFMLTLPFCGPNVIDSFFCD LPLVIKLACKDTYILQLLVIADSGLLSLVCFLLLLVSYGVIIFSVRYRAASRSSKAFSTL SAHITVVTLFFAPCVFIYVWPFSRYSVDKILSVFYTIFTPLLNPIIYTLRNQEVKAAIKK RLCI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ginsenoside Rb3
TRC-G387610-5MG 5 mg

Ginsenoside Rb3

Sign In for Pricing
View Details
Abrilumab Biosimilar - Research Grade
ICH5139-5mg 5 mg

Abrilumab Biosimilar - Research Grade

Sign In for Pricing
View Details
FITC Anti-Human CD4 Antibody[RPA-T4]
E-AB-F1109C-01 20 Tests

FITC Anti-Human CD4 Antibody[RPA-T4]

Sign In for Pricing
View Details
FITC Anti-Human CD4 Antibody[RPA-T4]
E-AB-F1109C-02 100 Tests

FITC Anti-Human CD4 Antibody[RPA-T4]

Sign In for Pricing
View Details
FITC Anti-Human CD4 Antibody[RPA-T4]
E-AB-F1109C-03 2x 100 Tests

FITC Anti-Human CD4 Antibody[RPA-T4]

Sign In for Pricing
View Details
Cdk1 / p34cdc2 Serine-Threonine Kinase (A17.1.1), Biotin conjugate, 0.1mg/mL
BNCB1083-100 1x 100 µL

Cdk1 / p34cdc2 Serine-Threonine Kinase (A17.1.1), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details