Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Mas-related G-protein coupled receptor member A5 (Mrgpra5)

This Recombinant Mouse Mas-related G-protein coupled receptor member A5 (Mrgpra5) spans the amino acid sequence from region 1-304.

Product Specifications

Product Name Alternative

Mas-related G-protein coupled receptor member A5

UniProt

Q91ZC7

Expression Region

1-304

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDKPLWKYGHLDSDPKLMIIIFRLVGMTGNAIVFWLLGFSLHRNAFSVYILNLALADFVF LLCHIIDSMLLLLTVFYPNNIFSGYFYTIMTVPYIAGLSMLSAISTELCLSVLCPIWYRC HHPEHTSTVMCAAIWVLPLLVCILNRYFCSFLDINYNNDKQCLASNFFTRAYLMFLFVVL CLSSMALLARLFCGTGQMKLTRLYVTIMLTVLGFLLCGLPFVIYYFLLFNIKDGFCLFDF RFYMSTHVLTAINNCANPIIYFFEGSFRHQLKHQTLKMVLQSVLQDTPEIAENMVEMSRN IPKP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ep-CAM / CD326 (VU-1D9), CF555 conjugate, 0.1mg/mL
BNC550017-100 1x 100 µL

Ep-CAM / CD326 (VU-1D9), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD106 / VCAM1 (B-K9), CF740 conjugate, 0.1mg/mL
BNC740304-500 1x 500 µL

CD106 / VCAM1 (B-K9), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TGF-beta (1D11.16.8), CF405S conjugate, 0.1mg/mL
BNC040977-500 1x 500 µL

TGF-beta (1D11.16.8), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 1 / EMA / Episialin / CD227 (VU-2G7), CF740 conjugate, 0.1mg/mL
BNC740630-100 1x 100 µL

Mucin 1 / EMA / Episialin / CD227 (VU-2G7), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD20 (B9E9), CF640R conjugate, 0.1mg/mL
BNC400160-100 1x 100 µL

CD20 (B9E9), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (T-Cell Marker) (UCHT1), CF647 conjugate, 0.1mg/mL
BNC472473-500 1x 500 µL

CD3e (T-Cell Marker) (UCHT1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details