Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Putative olfactory receptor 52A4 (OR52A4)

This Recombinant Human Putative olfactory receptor 52A4 (OR52A4) spans the amino acid sequence from region 1-304.

Product Specifications

Product Name Alternative

Putative olfactory receptor 52A4

UniProt

A6NMU1

Expression Region

1-304

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MALPITNGTLFMPFVLTFIGIPGFESVQCWIGIPFCATYVIALIGNSLLLIIIKSEPSLH EPMYIFLATLGATDISLSTSIVPKMLDIFWFHLPEIYFDACLFQMWLIHTFQGIESGVLL AMALDRCVAICYPLRRAIVFTRQLVTYIVVGVTLRPAILVIPCLLLIKCHLKLYRTKLIY HTYCERVALVKLATEDVYINKVYGILGAFIVGGLDFIFITLSYIQIFITVFHLPLKEARL KVFNTCIPHIYVFFQFYLLAFFFIFYSQIWILYPIICTYHLVQSLPTGPTIPQPLYLWVK DQTH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TBC1D22A Antibody, HRP conjugated
MBS1492328-01 0.05 mg

TBC1D22A Antibody, HRP conjugated

Sign In for Pricing
View Details
TBC1D22A Antibody, HRP conjugated
MBS1492328-02 0.1 mg

TBC1D22A Antibody, HRP conjugated

Sign In for Pricing
View Details
TBC1D22A Antibody, HRP conjugated
MBS1492328-03 5x 0.1 mg

TBC1D22A Antibody, HRP conjugated

Sign In for Pricing
View Details
Ethyl Propionylacetate-d3
TRC-E925397-5MG 5 mg

Ethyl Propionylacetate-d3

Sign In for Pricing
View Details
LARP6 Polyclonal Antibody, Biotin Conjugated
A70322-050 50 μL

LARP6 Polyclonal Antibody, Biotin Conjugated

Sign In for Pricing
View Details
Nei Antibody
orb814059 2 mg

Nei Antibody

Sign In for Pricing
View Details