Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Ictalurus punctatus Rhodopsin (rho)

This Recombinant Ictalurus punctatus Rhodopsin (rho) spans the amino acid sequence from region 1-304.

Product Specifications

Product Name Alternative

Rhodopsin

UniProt

O42268

Expression Region

1-304

Origin

Ictalurus punctatus (Channel catfish)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

YEYPQYYLVNPAAYAALGAYMFLLILVGFPINFLTLYVTIEHKKLRTPLNYILLNLAVAN LFMVFGGFTTTMFTSIRGYFVLGHLGCNLEGFFATLSGEIALWSLVVLAIERWVVVCKPI SNFRFGENHAIMGLAFTWTMAMACAAPPLVGWSRYIPEGMQCSCGIDYYTRAEGFNNESF VVYMFTCHFMTPLTIVFFCYGRLLCAVKEAAAAQQESETTQRAEREVTRMVVIMVIAFLI CWCPYAGVAWFIFTHQGSEFGPVFMTIPAFFAKSSSIYNPMIYICLNKQFRHCMITTLCC GKKA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SGK1 (NM_001143676) Human Over-expression Lysate
LY428312 100 µg

SGK1 (NM_001143676) Human Over-expression Lysate

Sign In for Pricing
View Details
GUCY1B1 (C-term) Rabbit Polyclonal Antibody
AP15185PU-N 400 µL

GUCY1B1 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human CMTM5 activation kit by CRISPRa
GA114573 1 Kit

Human CMTM5 activation kit by CRISPRa

Sign In for Pricing
View Details
14-3-3 zeta (YWHAZ) (NM_003406) Human Over-expression Lysate
LC401160 20 µg

14-3-3 zeta (YWHAZ) (NM_003406) Human Over-expression Lysate

Sign In for Pricing
View Details
Human CBX2 activation kit by CRISPRa
GA113678 1 Kit

Human CBX2 activation kit by CRISPRa

Sign In for Pricing
View Details
AMY2B (N-term) Rabbit Polyclonal Antibody
AP50167PU-N 400 µL

AMY2B (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details