Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Probable G-protein coupled receptor 141 (Gpr141)

This Recombinant Mouse Probable G-protein coupled receptor 141 (Gpr141) spans the amino acid sequence from region 1-305.

Product Specifications

Product Name Alternative

Probable G-protein coupled receptor 141, G-protein coupled receptor PGR13

UniProt

Q7TQP0

Expression Region

1-305

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDGYNTSENSSCDPILAHHLTSIYFIVLIGGLVGLISILFLLVKMNSRSVTTMAVINLVV VHGVFLLTVPFRLAYLIKGTWTFGLPFCKFVSAMLHIHMYLTFLFYVVILVIRYLIFFKR RDKVEFYRKLHAVAASSAMWLLVIVIVVPLVVSQYGNSEEYNEQQCFRFHKELGHDSVRV INYMIVIVVIAVALILLGFQVFITLSMVRKFRHSLLSHQEFWAQLKNLFFIGIIIICFLP YQFFRIYYLYVVAHSKSCKNKVAFYNEILLSTTAISCCDLLLFVFGGSHWVKQKIVDMWN CLLCH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Glypican-3 (h) : 293T Lysate
sc-176285 100 µg - 200 µL

Glypican-3 (h) : 293T Lysate

Sign In for Pricing
View Details
FXR1 Antibody
orb524191-01 50 μL

FXR1 Antibody

Sign In for Pricing
View Details
FXR1 Antibody
orb524191-02 100 µL

FXR1 Antibody

Sign In for Pricing
View Details
Phospho-PAK4/5/6 (Ser474/Ser602/Ser560) Recombinant Antibody, APC-Cy5.5 Conjugated
bsm-61674R-APC-Cy5.5 100 µL

Phospho-PAK4/5/6 (Ser474/Ser602/Ser560) Recombinant Antibody, APC-Cy5.5 Conjugated

Sign In for Pricing
View Details
Natriuretic Peptide Receptor A, NT (NPR1, ANPRA, Atrial natriuretic peptide receptor 1, Atrial natriuretic peptide receptor type A, Guanylate cyclase A) (FITC) discontinued
038811-FITC 200 µL

Natriuretic Peptide Receptor A, NT (NPR1, ANPRA, Atrial natriuretic peptide receptor 1, Atrial natriuretic peptide receptor type A, Guanylate cyclase A) (FITC) discontinued

Sign In for Pricing
View Details
ASH2L antibody - N-terminal region
MBS3213760-01 0.1 mL

ASH2L antibody - N-terminal region

Sign In for Pricing
View Details