Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Probable G-protein coupled receptor 141 (Gpr141)

This Recombinant Mouse Probable G-protein coupled receptor 141 (Gpr141) spans the amino acid sequence from region 1-305.

Product Specifications

Product Name Alternative

Probable G-protein coupled receptor 141, G-protein coupled receptor PGR13

UniProt

Q7TQP0

Expression Region

1-305

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDGYNTSENSSCDPILAHHLTSIYFIVLIGGLVGLISILFLLVKMNSRSVTTMAVINLVV VHGVFLLTVPFRLAYLIKGTWTFGLPFCKFVSAMLHIHMYLTFLFYVVILVIRYLIFFKR RDKVEFYRKLHAVAASSAMWLLVIVIVVPLVVSQYGNSEEYNEQQCFRFHKELGHDSVRV INYMIVIVVIAVALILLGFQVFITLSMVRKFRHSLLSHQEFWAQLKNLFFIGIIIICFLP YQFFRIYYLYVVAHSKSCKNKVAFYNEILLSTTAISCCDLLLFVFGGSHWVKQKIVDMWN CLLCH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Streptococcus pneumoniae PTS system glucose-specific EIICBA component (exp5), partial
MBS1157771-01 1 mg (E-Coli)

Recombinant Streptococcus pneumoniae PTS system glucose-specific EIICBA component (exp5), partial

Sign In for Pricing
View Details
Recombinant Streptococcus pneumoniae PTS system glucose-specific EIICBA component (exp5), partial
MBS1157771-02 1 mg (Yeast)

Recombinant Streptococcus pneumoniae PTS system glucose-specific EIICBA component (exp5), partial

Sign In for Pricing
View Details
Purified bovine histone, H2a/F2a2 and H4 (f2a1) (slightly lysine rich, ~14.5/11.3 kda) purified
HIST21-N-1 1 mg

Purified bovine histone, H2a/F2a2 and H4 (f2a1) (slightly lysine rich, ~14.5/11.3 kda) purified

Sign In for Pricing
View Details
Frozen Tissue Sections, Spleen
CS627762 5x 5 µm

Frozen Tissue Sections, Spleen

Sign In for Pricing
View Details
Mouse Or12d14-ps1 qPCR Primer Pair
QM64642S 200 Tests

Mouse Or12d14-ps1 qPCR Primer Pair

Sign In for Pricing
View Details
4933405L10Rik Mouse qPCR Primer Pair (NM_027655)
MP219604 200 Reactions

4933405L10Rik Mouse qPCR Primer Pair (NM_027655)

Sign In for Pricing
View Details