Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Taste receptor type 2 member 116 (Tas2r116)

This Recombinant Mouse Taste receptor type 2 member 116 (Tas2r116) spans the amino acid sequence from region 1-305.

Product Specifications

Product Name Alternative

Taste receptor type 2 member 116, T2R116, TRB1, mT2R56, TRB4

UniProt

Q7M713

Expression Region

1-305

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNGVLQVTFIVILSVEFIIGIFGNGFIAVVNIKDLVKGRKISSVDQILTALAISRIALLW LILVSWWIFVLYPGQWMTDRRVSIMHSIWTTFNQSSLWFATSLSIFYFFKIANFSNPIFL YLKVRLKKVMIGTLIMSLILFCLNIIIMNAPENILITEYNVSMSYSLILNNTQLSMLFPF ANTMFGFIPFAVSLVTFVLLVFSLWKHQRKMQHSAHGCRDASTKAHIRALQTLIASLLLY SIFFLSHVMKVWSALLLERTLLLLITQVARTAFPSVHSWVLILGNAKMRKASLYVFLWLR CRHKE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat soluble interleukin-2 receptor, IL-2sRα ELISA kit
YLA0564RA-01 48 Tests

Rat soluble interleukin-2 receptor, IL-2sRα ELISA kit

Sign In for Pricing
View Details
Rat soluble interleukin-2 receptor, IL-2sRα ELISA kit
YLA0564RA-02 96 Tests

Rat soluble interleukin-2 receptor, IL-2sRα ELISA kit

Sign In for Pricing
View Details
SOCS-7 (E-8) Alexa Fluor® 790
sc-137241 AF790 200 µg/mL

SOCS-7 (E-8) Alexa Fluor® 790

Sign In for Pricing
View Details
D-Glucitol-6,6'-d2
sc-490523 25 mg

D-Glucitol-6,6'-d2

Sign In for Pricing
View Details
pEnCMV-RBM10-IRES-EGFP-Puro Plasmid
PVT35999 2 µg

pEnCMV-RBM10-IRES-EGFP-Puro Plasmid

Sign In for Pricing
View Details
Reagecon 0.5 mg/L C from NIST Sucrose Total Organic Carbon (TOC) Standard for Anatel A1000 Analyser
ISTOC1038 1 L

Reagecon 0.5 mg/L C from NIST Sucrose Total Organic Carbon (TOC) Standard for Anatel A1000 Analyser

Sign In for Pricing
View Details