Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Taste receptor type 2 member 116 (Tas2r116)

This Recombinant Mouse Taste receptor type 2 member 116 (Tas2r116) spans the amino acid sequence from region 1-305.

Product Specifications

Product Name Alternative

Taste receptor type 2 member 116, T2R116, TRB1, mT2R56, TRB4

UniProt

Q7M713

Expression Region

1-305

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNGVLQVTFIVILSVEFIIGIFGNGFIAVVNIKDLVKGRKISSVDQILTALAISRIALLW LILVSWWIFVLYPGQWMTDRRVSIMHSIWTTFNQSSLWFATSLSIFYFFKIANFSNPIFL YLKVRLKKVMIGTLIMSLILFCLNIIIMNAPENILITEYNVSMSYSLILNNTQLSMLFPF ANTMFGFIPFAVSLVTFVLLVFSLWKHQRKMQHSAHGCRDASTKAHIRALQTLIASLLLY SIFFLSHVMKVWSALLLERTLLLLITQVARTAFPSVHSWVLILGNAKMRKASLYVFLWLR CRHKE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SIN1 Rabbit Polyclonal Antibody
BT-AP04752-01 20 µL

SIN1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SIN1 Rabbit Polyclonal Antibody
BT-AP04752-02 50 µL

SIN1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SIN1 Rabbit Polyclonal Antibody
BT-AP04752-03 100 µL

SIN1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Anti Mouse CD90.2 Flow Cytometry Monoclonal Clone 30H12 PE/Cyanine7 Ready To Use 100 Tests
IRTAMSCD90230H12CPECY7100 100 Tests

Anti Mouse CD90.2 Flow Cytometry Monoclonal Clone 30H12 PE/Cyanine7 Ready To Use 100 Tests

Sign In for Pricing
View Details
ZNF329 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI7F2]
TA809584BM 100 µL

ZNF329 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI7F2]

Sign In for Pricing
View Details
FLT4 Antibody
OAAD00365-100UL 0.1 mL

FLT4 Antibody

Sign In for Pricing
View Details