Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Olfactory receptor 1013 (Olfr1013)

This Recombinant Mouse Olfactory receptor 1013 (Olfr1013) spans the amino acid sequence from region 1-305.

Product Specifications

Product Name Alternative

Olfactory receptor 1013, Olfactory receptor 213-2

UniProt

Q7TR96

Expression Region

1-305

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDQNNNTVSEFIMLGFTTDPVIQKVLFAVFLVVYTLTLMGNSSLIMLICNDSRLHTPMYF FIGNLSFLDLGLSSVYTPKILETCISEDKSISFAGCVAQFFFSAALDYTECYLLAAMAYD RYVAISKPLLYSQAMSLKLCVCFVVASYVGGFINSVIITKDTFALTFCNDNVIDDFFCDI PPLVKLACGKKKSFQSVLFFLLTSNVIIPIVFILATYLFIIATILRIRSTQGRLKAFSTC SSHLISVTLYYGSILYIYARPRSSYSLDRDKIVSTFYTVVFPMLNPLIYSLRNKDVKEAL NKLLK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pick1 (NM_053460) Rat Tagged ORF Clone
RR201340 10 µg

Pick1 (NM_053460) Rat Tagged ORF Clone

Sign In for Pricing
View Details
Rabbit Anti-SYT8 Polyclonal Antibody
PAV3904 100 μL

Rabbit Anti-SYT8 Polyclonal Antibody

Sign In for Pricing
View Details
Mouse Mir6367 qPCR Primer Pair
QM80386S 200 Tests

Mouse Mir6367 qPCR Primer Pair

Sign In for Pricing
View Details
Rabbit Polyclonal Dcp1a Antibody [Alexa Fluor 488]
NBP2-04038AF488 0.1 mL

Rabbit Polyclonal Dcp1a Antibody [Alexa Fluor 488]

Sign In for Pricing
View Details
CPT2 (NM_000098) Human Recombinant Protein
TP300484 20 µg

CPT2 (NM_000098) Human Recombinant Protein

Sign In for Pricing
View Details
p70 S6 Kinase 1 Rabbit pAb
A0447 100 µL

p70 S6 Kinase 1 Rabbit pAb

Sign In for Pricing
View Details