Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Olfactory receptor 1013 (Olfr1013)

This Recombinant Mouse Olfactory receptor 1013 (Olfr1013) spans the amino acid sequence from region 1-305.

Product Specifications

Product Name Alternative

Olfactory receptor 1013, Olfactory receptor 213-2

UniProt

Q7TR96

Expression Region

1-305

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDQNNNTVSEFIMLGFTTDPVIQKVLFAVFLVVYTLTLMGNSSLIMLICNDSRLHTPMYF FIGNLSFLDLGLSSVYTPKILETCISEDKSISFAGCVAQFFFSAALDYTECYLLAAMAYD RYVAISKPLLYSQAMSLKLCVCFVVASYVGGFINSVIITKDTFALTFCNDNVIDDFFCDI PPLVKLACGKKKSFQSVLFFLLTSNVIIPIVFILATYLFIIATILRIRSTQGRLKAFSTC SSHLISVTLYYGSILYIYARPRSSYSLDRDKIVSTFYTVVFPMLNPLIYSLRNKDVKEAL NKLLK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Z804A Antibody
C47218-01 50 µL

Z804A Antibody

Sign In for Pricing
View Details
Z804A Antibody
C47218-02 100 µL

Z804A Antibody

Sign In for Pricing
View Details
4-Hydroxy-6-oxohexanoic Acid Dicyclohexylamine Salt
sc-491204 10 mg

4-Hydroxy-6-oxohexanoic Acid Dicyclohexylamine Salt

Sign In for Pricing
View Details
Recombinant Clostridium botulinum ATP phosphoribosyltransferase regulatory subunit (hisZ)
MBS1155775-01 0.02 mg (E-Coli)

Recombinant Clostridium botulinum ATP phosphoribosyltransferase regulatory subunit (hisZ)

Sign In for Pricing
View Details
Recombinant Clostridium botulinum ATP phosphoribosyltransferase regulatory subunit (hisZ)
MBS1155775-02 0.02 mg (Yeast)

Recombinant Clostridium botulinum ATP phosphoribosyltransferase regulatory subunit (hisZ)

Sign In for Pricing
View Details
Recombinant Clostridium botulinum ATP phosphoribosyltransferase regulatory subunit (hisZ)
MBS1155775-03 0.1 mg (E-Coli)

Recombinant Clostridium botulinum ATP phosphoribosyltransferase regulatory subunit (hisZ)

Sign In for Pricing
View Details