Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable G-protein coupled receptor 141 (GPR141)

This Recombinant Human Probable G-protein coupled receptor 141 (GPR141) spans the amino acid sequence from region 1-305.

Product Specifications

Product Name Alternative

Probable G-protein coupled receptor 141, G-protein coupled receptor PGR13

UniProt

Q7Z602

Expression Region

1-305

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPGHNTSRNSSCDPIVTPHLISLYFIVLIGGLVGVISILFLLVKMNTRSVTTMAVINLVV VHSVFLLTVPFRLTYLIKKTWMFGLPFCKFVSAMLHIHMYLTFLFYVVILVTRYLIFFKC KDKVEFYRKLHAVAASAGMWTLVIVIVVPLVVSRYGIHEEYNEEHCFKFHKELAYTYVKI INYMIVIFVIAVAVILLVFQVFIIMLMVQKLRHSLLSHQEFWAQLKNLFFIGVILVCFLP YQFFRIYYLNVVTHSNACNSKVAFYNEIFLSVTAISCYDLLLFVFGGSHWFKQKIIGLWN CVLCR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OR2A42 (NM_001001802) Human Over-expression Lysate
LC424247 20 µg

OR2A42 (NM_001001802) Human Over-expression Lysate

Sign In for Pricing
View Details
Mouse Ddb1 activation kit by CRISPRa
GA201038 1 Kit

Mouse Ddb1 activation kit by CRISPRa

Sign In for Pricing
View Details
APC Goat Anti-Rat IgG (H+L) Antibody[Poly1441]
AN00339E-01 50 Tests

APC Goat Anti-Rat IgG (H+L) Antibody[Poly1441]

Sign In for Pricing
View Details
APC Goat Anti-Rat IgG (H+L) Antibody[Poly1441]
AN00339E-02 100 Tests

APC Goat Anti-Rat IgG (H+L) Antibody[Poly1441]

Sign In for Pricing
View Details
APC Goat Anti-Rat IgG (H+L) Antibody[Poly1441]
AN00339E-03 2x 100 Tests

APC Goat Anti-Rat IgG (H+L) Antibody[Poly1441]

Sign In for Pricing
View Details
Mouse Stx7 activation kit by CRISPRa
GA205554 1 Kit

Mouse Stx7 activation kit by CRISPRa

Sign In for Pricing
View Details