Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable G-protein coupled receptor 141 (GPR141)

This Recombinant Human Probable G-protein coupled receptor 141 (GPR141) spans the amino acid sequence from region 1-305.

Product Specifications

Product Name Alternative

Probable G-protein coupled receptor 141, G-protein coupled receptor PGR13

UniProt

Q7Z602

Expression Region

1-305

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPGHNTSRNSSCDPIVTPHLISLYFIVLIGGLVGVISILFLLVKMNTRSVTTMAVINLVV VHSVFLLTVPFRLTYLIKKTWMFGLPFCKFVSAMLHIHMYLTFLFYVVILVTRYLIFFKC KDKVEFYRKLHAVAASAGMWTLVIVIVVPLVVSRYGIHEEYNEEHCFKFHKELAYTYVKI INYMIVIFVIAVAVILLVFQVFIIMLMVQKLRHSLLSHQEFWAQLKNLFFIGVILVCFLP YQFFRIYYLNVVTHSNACNSKVAFYNEIFLSVTAISCYDLLLFVFGGSHWFKQKIIGLWN CVLCR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Myosin Phosphatase (PPP1R12A) (NM_002480) Human Over-expression Lysate
LC400883 20 µg

Myosin Phosphatase (PPP1R12A) (NM_002480) Human Over-expression Lysate

Sign In for Pricing
View Details
ACS2L Antibody
8C14234-AAT 50 µg

ACS2L Antibody

Sign In for Pricing
View Details
Cholera Toxin B, CF®647 Conjugate, 100 ug
#00069 1x 100 µg

Cholera Toxin B, CF®647 Conjugate, 100 ug

Sign In for Pricing
View Details
PROCR (NM_006404) Human Recombinant Protein
TP761291 50 µg

PROCR (NM_006404) Human Recombinant Protein

Sign In for Pricing
View Details
CDK15 Polyclonal Antibody
E-AB-90591-01 60 µL

CDK15 Polyclonal Antibody

Sign In for Pricing
View Details
CDK15 Polyclonal Antibody
E-AB-90591-02 120 µL

CDK15 Polyclonal Antibody

Sign In for Pricing
View Details