Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable G-protein coupled receptor 141 (GPR141)

This Recombinant Human Probable G-protein coupled receptor 141 (GPR141) spans the amino acid sequence from region 1-305.

Product Specifications

Product Name Alternative

Probable G-protein coupled receptor 141, G-protein coupled receptor PGR13

UniProt

Q7Z602

Expression Region

1-305

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPGHNTSRNSSCDPIVTPHLISLYFIVLIGGLVGVISILFLLVKMNTRSVTTMAVINLVV VHSVFLLTVPFRLTYLIKKTWMFGLPFCKFVSAMLHIHMYLTFLFYVVILVTRYLIFFKC KDKVEFYRKLHAVAASAGMWTLVIVIVVPLVVSRYGIHEEYNEEHCFKFHKELAYTYVKI INYMIVIFVIAVAVILLVFQVFIIMLMVQKLRHSLLSHQEFWAQLKNLFFIGVILVCFLP YQFFRIYYLNVVTHSNACNSKVAFYNEIFLSVTAISCYDLLLFVFGGSHWFKQKIIGLWN CVLCR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IFluor® 830 succinimidyl ester
71400-AAT 100 µg

IFluor® 830 succinimidyl ester

Sign In for Pricing
View Details
Recombinant Human Carboxypeptidase A2/CPA2 Protein (His Tag)
PKSH032169-01 10 µg

Recombinant Human Carboxypeptidase A2/CPA2 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human Carboxypeptidase A2/CPA2 Protein (His Tag)
PKSH032169-02 50 µg

Recombinant Human Carboxypeptidase A2/CPA2 Protein (His Tag)

Sign In for Pricing
View Details
Human BICC1 activation kit by CRISPRa
GA112818 1 Kit

Human BICC1 activation kit by CRISPRa

Sign In for Pricing
View Details
Extendable Delivery Jet
LS-904 1 Jet

Extendable Delivery Jet

Sign In for Pricing
View Details
CD25 / IL-2 Receptor alpha Recombinant Mouse monoclonal Antibody
HA601530F 100 Tests

CD25 / IL-2 Receptor alpha Recombinant Mouse monoclonal Antibody

Sign In for Pricing
View Details