Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 10W1 (OR10W1)

This Recombinant Human Olfactory receptor 10W1 (OR10W1) spans the amino acid sequence from region 1-305.

Product Specifications

Product Name Alternative

Olfactory receptor 10W1, Olfactory receptor OR11-236

UniProt

Q8NGF6

Expression Region

1-305

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEFVFLAYPSCPELHILSFLGVSLVYGLIITGNILIVVSIHTETCLCTSMYYFLGSLSGI EICYTAVVVPHILANTLQSEKTITLLGCATQMAFFIALGSADCFLLAAMAYDRYVAICHP LQYPLLMTLTLCVHLVVASVISGLFLSLQLVAFIFSLPFCQAQGIEHFFCDVPPVMHVVC AQSHIHEQSVLVAAILAIAVPFFLITTSYTFIVAALLKIHSAAGRHRAFSTCSSHLTVVL LQYGCCAFMYLCPSSSYNPKQDRFISLVYTLGTPLLNPLIYALRNSEMKGAVGRVLTRNC LSQNS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human ADAM18 activation kit by CRISPRa
GA105812 1 Kit

Human ADAM18 activation kit by CRISPRa

Sign In for Pricing
View Details
Biotin Conjugated Goat Affinity Purified Antibody to Equine IgG,
BAF-431-1 1 mL

Biotin Conjugated Goat Affinity Purified Antibody to Equine IgG,

Sign In for Pricing
View Details
Tissue Protein Lysate, Prostate
CP565559 150 µg

Tissue Protein Lysate, Prostate

Sign In for Pricing
View Details
Glucose Transporter GLUT4 Recombinant Rabbit monoclonal Antibody
HA751336 100 µL

Glucose Transporter GLUT4 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
PE/Cyanine5.5 Anti-Human CD15/SSEA-1 Antibody[HI98]
E-AB-F1079I-01 20 Tests

PE/Cyanine5.5 Anti-Human CD15/SSEA-1 Antibody[HI98]

Sign In for Pricing
View Details
PE/Cyanine5.5 Anti-Human CD15/SSEA-1 Antibody[HI98]
E-AB-F1079I-02 100 Tests

PE/Cyanine5.5 Anti-Human CD15/SSEA-1 Antibody[HI98]

Sign In for Pricing
View Details