Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 10W1 (OR10W1)

This Recombinant Human Olfactory receptor 10W1 (OR10W1) spans the amino acid sequence from region 1-305.

Product Specifications

Product Name Alternative

Olfactory receptor 10W1, Olfactory receptor OR11-236

UniProt

Q8NGF6

Expression Region

1-305

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEFVFLAYPSCPELHILSFLGVSLVYGLIITGNILIVVSIHTETCLCTSMYYFLGSLSGI EICYTAVVVPHILANTLQSEKTITLLGCATQMAFFIALGSADCFLLAAMAYDRYVAICHP LQYPLLMTLTLCVHLVVASVISGLFLSLQLVAFIFSLPFCQAQGIEHFFCDVPPVMHVVC AQSHIHEQSVLVAAILAIAVPFFLITTSYTFIVAALLKIHSAAGRHRAFSTCSSHLTVVL LQYGCCAFMYLCPSSSYNPKQDRFISLVYTLGTPLLNPLIYALRNSEMKGAVGRVLTRNC LSQNS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CRYGD Mouse Monoclonal Antibody [Clone ID: OTI4C1]
CF811956 100 µg

CRYGD Mouse Monoclonal Antibody [Clone ID: OTI4C1]

Sign In for Pricing
View Details
ARHGAP9 (NM_001080156) Human Recombinant Protein
TP322813M 100 µg

ARHGAP9 (NM_001080156) Human Recombinant Protein

Sign In for Pricing
View Details
Cadherin 17 / LI Cadherin (Liver-Intestine Marker) (CDH17/2618), CF594 conjugate, 0.1mg/mL
BNC942618-500 1x 500 µL

Cadherin 17 / LI Cadherin (Liver-Intestine Marker) (CDH17/2618), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
RRP12 (NM_001145114) Human Over-expression Lysate
LC428700 20 µg

RRP12 (NM_001145114) Human Over-expression Lysate

Sign In for Pricing
View Details
CD8a Mouse Monoclonal Antibody (SK1), CF®660C Conjugate - Biotium Choice
P009-660C-125 1x 125 µL

CD8a Mouse Monoclonal Antibody (SK1), CF®660C Conjugate - Biotium Choice

Sign In for Pricing
View Details
Radixin (RDX) Human Knockdown Lysate
LY300420 100 µg

Radixin (RDX) Human Knockdown Lysate

Sign In for Pricing
View Details