Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Mas-related G-protein coupled receptor member A7 (Mrgpra7)

This Recombinant Mouse Mas-related G-protein coupled receptor member A7 (Mrgpra7) spans the amino acid sequence from region 1-305.

Product Specifications

Product Name Alternative

Mas-related G-protein coupled receptor member A7

UniProt

Q91ZC5

Expression Region

1-305

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDETSPRSIDIESLIPNLMIIIFGLVGLTGNAIVLWLLGFCLHRNAFLVYILNLALADFL FLLCHFINSAMFLLKVPIPNGIFVYCFYTIKMVLYITGLSMLSAISTERCLSVLCPIWYH CRRPEHTSTVMCAVIWIFSVLICILKEYFCDFFGTKLGNYYVCQASNFFMGAYLMFLFVV LCLSTLALLARLFCGAEKMKFTRLFVTIMLTILVFLLCGLPWGFFWFLLIWIKGGFSVLD YRLYLASIVLTVVNSCANPIIYFFVGSFRHRLKHQTLKMVLQSALQDTPETHENMVEMSR IKAEQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CBX5 (Chromobox Protein Homolog 5, Antigen p25, Heterochromatin Protein 1 Homolog alpha, HP1 alpha, HP1A) (MaxLight 750)
MBS6372441-01 0.1 mL

CBX5 (Chromobox Protein Homolog 5, Antigen p25, Heterochromatin Protein 1 Homolog alpha, HP1 alpha, HP1A) (MaxLight 750)

Sign In for Pricing
View Details
CBX5 (Chromobox Protein Homolog 5, Antigen p25, Heterochromatin Protein 1 Homolog alpha, HP1 alpha, HP1A) (MaxLight 750)
MBS6372441-02 5x 0.1 mL

CBX5 (Chromobox Protein Homolog 5, Antigen p25, Heterochromatin Protein 1 Homolog alpha, HP1 alpha, HP1A) (MaxLight 750)

Sign In for Pricing
View Details
Proflavine hemisulfate salt hydrate
GT1397-5g 5 g

Proflavine hemisulfate salt hydrate

Sign In for Pricing
View Details
D-myo-Inositol 1,4,5-trisphosphate hexapotassium salt 10mg
A19958-10 10 mg

D-myo-Inositol 1,4,5-trisphosphate hexapotassium salt 10mg

Sign In for Pricing
View Details
Human MTPAP shRNA Plasmid
abx960505-01 150 µg

Human MTPAP shRNA Plasmid

Sign In for Pricing
View Details
Human MTPAP shRNA Plasmid
abx960505-02 300 µg

Human MTPAP shRNA Plasmid

Sign In for Pricing
View Details