Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Mas-related G-protein coupled receptor member A7 (Mrgpra7)

This Recombinant Mouse Mas-related G-protein coupled receptor member A7 (Mrgpra7) spans the amino acid sequence from region 1-305.

Product Specifications

Product Name Alternative

Mas-related G-protein coupled receptor member A7

UniProt

Q91ZC5

Expression Region

1-305

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDETSPRSIDIESLIPNLMIIIFGLVGLTGNAIVLWLLGFCLHRNAFLVYILNLALADFL FLLCHFINSAMFLLKVPIPNGIFVYCFYTIKMVLYITGLSMLSAISTERCLSVLCPIWYH CRRPEHTSTVMCAVIWIFSVLICILKEYFCDFFGTKLGNYYVCQASNFFMGAYLMFLFVV LCLSTLALLARLFCGAEKMKFTRLFVTIMLTILVFLLCGLPWGFFWFLLIWIKGGFSVLD YRLYLASIVLTVVNSCANPIIYFFVGSFRHRLKHQTLKMVLQSALQDTPETHENMVEMSR IKAEQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SDR42E1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
43273111 3x 1.0 µg

SDR42E1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Calhm1 ORF Vector (Rat) (pORF)
14929016 1.0 µg DNA

Calhm1 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
Pigeon Follistatin ELISA Kit
MBS098595 Inquire

Pigeon Follistatin ELISA Kit

Sign In for Pricing
View Details
1- (3,5-dimethyl-2- ((4-methylbenzyl) oxy) phenyl) -2-fluoroethanone
PC1020488-01 250 mg

1- (3,5-dimethyl-2- ((4-methylbenzyl) oxy) phenyl) -2-fluoroethanone

Sign In for Pricing
View Details
1- (3,5-dimethyl-2- ((4-methylbenzyl) oxy) phenyl) -2-fluoroethanone
PC1020488-02 500 mg

1- (3,5-dimethyl-2- ((4-methylbenzyl) oxy) phenyl) -2-fluoroethanone

Sign In for Pricing
View Details
1- (3,5-dimethyl-2- ((4-methylbenzyl) oxy) phenyl) -2-fluoroethanone
PC1020488-03 1 g

1- (3,5-dimethyl-2- ((4-methylbenzyl) oxy) phenyl) -2-fluoroethanone

Sign In for Pricing
View Details