Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Mas-related G-protein coupled receptor member A2 (Mrgpra2)

This Recombinant Mouse Mas-related G-protein coupled receptor member A2 (Mrgpra2) spans the amino acid sequence from region 1-305.

Product Specifications

Product Name Alternative

Mas-related G-protein coupled receptor member A2

UniProt

Q91WW4

Expression Region

1-305

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDETLPGSINIRILIPKLMIIIFGLVGLMGNAIVFWLLGFHLRRNAFSVYILNLALADFL FLLSSIIASTLFLLKVSYLSIIFHLCFNTIMMVVYITGISMLSAISTECCLSVLCPTWYR CHRPVHTSTVMCAVIWVLSLLICILNSYFCAVLHTRYDNDNECLATNIFTASYMIFLLVV LCLSSLALLARLFCGAGQMKLTRFHVTILLTLLVFLLCGLPFVIYCILLFKIKDDFHVLD VNFYLALEVLTAINSCANPIIYFFVGSFRHQLKHQTLKMVLQSALQDTPETAENMVEMSS NKAEP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Emx1 (G-6) AC
sc-398115 AC 500 µg/mL - 25% ag

Emx1 (G-6) AC

Sign In for Pricing
View Details
(R) -5- (Azidomethyl) -3-[3-Fluoro-4- (4-Morpholinyl) Phenyl]-2-Oxazolidinone
PC108812-01 5 g

(R) -5- (Azidomethyl) -3-[3-Fluoro-4- (4-Morpholinyl) Phenyl]-2-Oxazolidinone

Sign In for Pricing
View Details
(R) -5- (Azidomethyl) -3-[3-Fluoro-4- (4-Morpholinyl) Phenyl]-2-Oxazolidinone
PC108812-02 25 g

(R) -5- (Azidomethyl) -3-[3-Fluoro-4- (4-Morpholinyl) Phenyl]-2-Oxazolidinone

Sign In for Pricing
View Details
(R) -5- (Azidomethyl) -3-[3-Fluoro-4- (4-Morpholinyl) Phenyl]-2-Oxazolidinone
PC108812-03 100 g

(R) -5- (Azidomethyl) -3-[3-Fluoro-4- (4-Morpholinyl) Phenyl]-2-Oxazolidinone

Sign In for Pricing
View Details
(R) -5- (Azidomethyl) -3-[3-Fluoro-4- (4-Morpholinyl) Phenyl]-2-Oxazolidinone
PC108812-04 500 g

(R) -5- (Azidomethyl) -3-[3-Fluoro-4- (4-Morpholinyl) Phenyl]-2-Oxazolidinone

Sign In for Pricing
View Details
Rat Anti-Mouse CD5/Lyt-1, Antibody
GWB-99F02C 0.1 mg

Rat Anti-Mouse CD5/Lyt-1, Antibody

Sign In for Pricing
View Details