Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Mas-related G-protein coupled receptor member A2 (Mrgpra2)

This Recombinant Mouse Mas-related G-protein coupled receptor member A2 (Mrgpra2) spans the amino acid sequence from region 1-305.

Product Specifications

Product Name Alternative

Mas-related G-protein coupled receptor member A2

UniProt

Q91WW4

Expression Region

1-305

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDETLPGSINIRILIPKLMIIIFGLVGLMGNAIVFWLLGFHLRRNAFSVYILNLALADFL FLLSSIIASTLFLLKVSYLSIIFHLCFNTIMMVVYITGISMLSAISTECCLSVLCPTWYR CHRPVHTSTVMCAVIWVLSLLICILNSYFCAVLHTRYDNDNECLATNIFTASYMIFLLVV LCLSSLALLARLFCGAGQMKLTRFHVTILLTLLVFLLCGLPFVIYCILLFKIKDDFHVLD VNFYLALEVLTAINSCANPIIYFFVGSFRHQLKHQTLKMVLQSALQDTPETAENMVEMSS NKAEP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PPAR Gamma Rabbit Polyclonal Antibody (BF594)
orb1600167 100 µL

PPAR Gamma Rabbit Polyclonal Antibody (BF594)

Sign In for Pricing
View Details
FAM129B/NIBAN2 Rabbit Polyclonal Antibody (FITC)
orb2600580 100 µg

FAM129B/NIBAN2 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
NrCAM Antibody, Clone N364/51: FITC
SMC-462D-FITC 100 µg

NrCAM Antibody, Clone N364/51: FITC

Sign In for Pricing
View Details
ANKH antibody - N-terminal region (ARP50237_P050)
ARP50237_P050 100 µL

ANKH antibody - N-terminal region (ARP50237_P050)

Sign In for Pricing
View Details
Recombinant Dechloromonas aromatica 3-isopropylmalate dehydratase large subunit (leuC)
MBS1281520-01 0.02 mg (E-Coli)

Recombinant Dechloromonas aromatica 3-isopropylmalate dehydratase large subunit (leuC)

Sign In for Pricing
View Details
Recombinant Dechloromonas aromatica 3-isopropylmalate dehydratase large subunit (leuC)
MBS1281520-02 0.02 mg (Yeast)

Recombinant Dechloromonas aromatica 3-isopropylmalate dehydratase large subunit (leuC)

Sign In for Pricing
View Details