Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 4F5 (OR4F5)

This Recombinant Human Olfactory receptor 4F5 (OR4F5) spans the amino acid sequence from region 1-305.

Product Specifications

Product Name Alternative

Olfactory receptor 4F5

UniProt

Q8NH21

Expression Region

1-305

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVTEFIFLGLSDSQELQTFLFMLFFVFYGGIVFGNLLIVITVVSDSHLHSPMYFLLANLS LIDLSLSSVTAPKMITDFFSQRKVISFKGCLVQIFLLHFFGGSEMVILIAMGFDRYIAIC KPLHYTTIMCGNACVGIMAVTWGIGFLHSVSQLAFAVHLLFCGPNEVDSFYCDLPRVIKL ACTDTYRLDIMVIANSGVLTVCSFVLLIISYTIILMTIQHRPLDKSSKALSTLTAHITVV LLFFGPCVFIYAWPFPIKSLDKFLAVFYSVITPLLNPIIYTLRNKDMKTAIRQLRKWDAH SSVKF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Defb21 sgRNA CRISPR Lentivector (Rat) (Target 3)
K6008604 1.0 µg DNA

Defb21 sgRNA CRISPR Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
Rat Growth factor receptor-bound protein 2,GRB2 ELISA KIT
JOT-EK1996Ra-01 96 Well

Rat Growth factor receptor-bound protein 2,GRB2 ELISA KIT

Sign In for Pricing
View Details
Rat Growth factor receptor-bound protein 2,GRB2 ELISA KIT
JOT-EK1996Ra-02 48 Well

Rat Growth factor receptor-bound protein 2,GRB2 ELISA KIT

Sign In for Pricing
View Details
HoxC5 siRNA (m)
sc-75288 10 µM

HoxC5 siRNA (m)

Sign In for Pricing
View Details
Recombinant IAV H5N1 NA Protein (aa 36-449)
VAng-0662Lsx-1mg 1 mg

Recombinant IAV H5N1 NA Protein (aa 36-449)

Sign In for Pricing
View Details
ERVPABLB-1 Protein Vector (Human) (pPM-C-HA)
PV076119 500 ng

ERVPABLB-1 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details