Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chlamydia muridarum Phosphatidate cytidylyltransferase (cdsA)

This Recombinant Chlamydia muridarum Phosphatidate cytidylyltransferase (cdsA) spans the amino acid sequence from region 1-305.

Product Specifications

Product Name Alternative

Phosphatidate cytidylyltransferase, EC= 2.7.7.41, CDP-DAG synthase, CDP-DG synthase, CDP-diacylglycerol synthase, CDS, CDP-diglyceride pyrophosphorylase, CDP-diglyceride syn

UniProt

Q9PJU1

Expression Region

1-305

Origin

Chlamydia muridarum (strain MoPn / Nigg)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFDSDKNSILQSDFCQRLVVHSLLLVFLVILLCTSLYPSSAFIVGLLSSTCAAIGTYEMS SMVRMKFPFSFTRYSSIGSAIFVALTCLTARCKMLLPEHVDLIPWFFLFFWTVHLVFKSR HYKLGPIGSTGLALFCMLYVSVPIRLFLHILYGFVHTDTPFIGIWWAIFLIATTKSSDIF GYFFGKAFGKKRIAPVISPNKTVVGFVAGCIASILVSLIFYSHLPKSFANQIAMPWILVA LGIILGISGFFGDIIESTFKRDAQIKNSSDLESIGGMLDVLDSLLLSTPIVYAILLITQN GTFLG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Calpain 1 (CAPN1/1530), 0.2mg/mL
BNUB1530-100 1x 100 µL

Calpain 1 (CAPN1/1530), 0.2mg/mL

Sign In for Pricing
View Details
Tissue FFPE Sections, Nose
CS803338 5x 5 µm

Tissue FFPE Sections, Nose

Sign In for Pricing
View Details
HSP60 (Heat Shock Protein 60) (Mitochondrial Marker) (rGROEL/780), 0.2mg/mL
BNUB2207-500 1x 500 µL

HSP60 (Heat Shock Protein 60) (Mitochondrial Marker) (rGROEL/780), 0.2mg/mL

Sign In for Pricing
View Details
Benzoic Acid-13C6
TRC-B203903-10MG 10 mg

Benzoic Acid-13C6

Sign In for Pricing
View Details
POTEG Mouse Monoclonal Antibody [Clone ID: OTI4F6]
CF808190 100 µg

POTEG Mouse Monoclonal Antibody [Clone ID: OTI4F6]

Sign In for Pricing
View Details
CRYL1 Antibody
KC-31847-01 50 μL

CRYL1 Antibody

Sign In for Pricing
View Details