Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chlamydia muridarum Phosphatidate cytidylyltransferase (cdsA)

This Recombinant Chlamydia muridarum Phosphatidate cytidylyltransferase (cdsA) spans the amino acid sequence from region 1-305.

Product Specifications

Product Name Alternative

Phosphatidate cytidylyltransferase, EC= 2.7.7.41, CDP-DAG synthase, CDP-DG synthase, CDP-diacylglycerol synthase, CDS, CDP-diglyceride pyrophosphorylase, CDP-diglyceride syn

UniProt

Q9PJU1

Expression Region

1-305

Origin

Chlamydia muridarum (strain MoPn / Nigg)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFDSDKNSILQSDFCQRLVVHSLLLVFLVILLCTSLYPSSAFIVGLLSSTCAAIGTYEMS SMVRMKFPFSFTRYSSIGSAIFVALTCLTARCKMLLPEHVDLIPWFFLFFWTVHLVFKSR HYKLGPIGSTGLALFCMLYVSVPIRLFLHILYGFVHTDTPFIGIWWAIFLIATTKSSDIF GYFFGKAFGKKRIAPVISPNKTVVGFVAGCIASILVSLIFYSHLPKSFANQIAMPWILVA LGIILGISGFFGDIIESTFKRDAQIKNSSDLESIGGMLDVLDSLLLSTPIVYAILLITQN GTFLG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Weighing Scale BBAL-417
BBAL-417 1 Unit

Weighing Scale BBAL-417

Sign In for Pricing
View Details
Colloidal Gold Conjugated Goat Affinity Purified Antibody to Human Kappa (Free & Bound),  30nm
GAF-007-30 1 mL

Colloidal Gold Conjugated Goat Affinity Purified Antibody to Human Kappa (Free & Bound), 30nm

Sign In for Pricing
View Details
Chloroacetaldehyde Diethyl Acetal
TRC-C292785-50G 50 g

Chloroacetaldehyde Diethyl Acetal

Sign In for Pricing
View Details
PDGFR alpha Recombinant Rabbit monoclonal Antibody [JF104-6]
ET1702-49-50UL 50 µL

PDGFR alpha Recombinant Rabbit monoclonal Antibody [JF104-6]

Sign In for Pricing
View Details
Frozen Tissue Blocks, Lung
CB504699 1 Block

Frozen Tissue Blocks, Lung

Sign In for Pricing
View Details
Moesin (MSN/492), CF488A conjugate, 0.1mg/mL
BNC880492-100 1x 100 µL

Moesin (MSN/492), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details