Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human CD97 antigen (CD97)

This Recombinant Human CD97 antigen (CD97) spans the amino acid sequence from region 531-835.

Product Specifications

Product Name Alternative

CD97 antigen, Leukocyte antigen CD97, CD_antigen= CD97, Cleaved into the following 2 chains:, 1. CD97 antigen subunit alpha, 2. CD97 antigen subunit beta

UniProt

P48960

Expression Region

531-835

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

SSFAILMAHYDVEDWKLTLITRVGLALSLFCLLLCILTFLLVRPIQGSRTTIHLHLCICL FVGSTIFLAGIENEGGQVGLRCRLVAGLLHYCFLAAFCWMSLEGLELYFLVVRVFQGQGL STRWLCLIGYGVPLLIVGVSAAIYSKGYGRPRYCWLDFEQGFLWSFLGPVTFIILCNAVI FVTTVWKLTQKFSEINPDMKKLKKARALTITAIAQLFLLGCTWVFGLFIFDDRSLVLTYV FTILNCLQGAFLYLLHCLLNKKVREEYRKWACLVAGGSKYSEFTSTTSGTGHNQTRALRA SESGI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Potassium inwardly-rectifying channel, subfamily J, member 11
330212 100 µL

Potassium inwardly-rectifying channel, subfamily J, member 11

Sign In for Pricing
View Details
Sun
T8610 50 mg

Sun

Sign In for Pricing
View Details
BAK1 (Bcl-2 Homologous Antagonist/Killer, Apoptosis Regulator BAK, Bcl-2-like Protein 7, Bcl2-L-7, BAK, BCL2L7, CDN1) (MaxLight 490)
123823-ML490 100 µL

BAK1 (Bcl-2 Homologous Antagonist/Killer, Apoptosis Regulator BAK, Bcl-2-like Protein 7, Bcl2-L-7, BAK, BCL2L7, CDN1) (MaxLight 490)

Sign In for Pricing
View Details
PBK/TOPK (Phospho-Thr9) Antibody
MBS859610-01 0.1 mg

PBK/TOPK (Phospho-Thr9) Antibody

Sign In for Pricing
View Details
PBK/TOPK (Phospho-Thr9) Antibody
MBS859610-02 0.1 mL (AF635)

PBK/TOPK (Phospho-Thr9) Antibody

Sign In for Pricing
View Details
PBK/TOPK (Phospho-Thr9) Antibody
MBS859610-03 0.1 mL (AF610)

PBK/TOPK (Phospho-Thr9) Antibody

Sign In for Pricing
View Details