Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat P2Y purinoceptor 14 (P2ry14)

This Recombinant Rat P2Y purinoceptor 14 (P2ry14) spans the amino acid sequence from region 1-305.

Product Specifications

Product Name Alternative

P2Y purinoceptor 14, P2Y14, G-protein coupled receptor 105, UDP-glucose receptor, VTR 15-20

UniProt

O35881

Expression Region

1-305

Origin

Rattus norvegicus (Rat)

Field of Research

Cardiovascular Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDNTTTTEPPKQPCTRNTLITQQIIPMLYCVVFITGVLLNGISGWIFFYVPSSKSFIIYL KNIVVADFLMGLTFPFKVLSDSGLGPWQLNVFVFRVSAVIFYVNMYVSIAFFGLISFDRY YKIVKPLLVSIVQSVNYSKVLSVLVWVLMLLLAVPNIILTNQSVKDVTNIQCMELKNELG RKWHKASNYVFVSIFWIVFLLLTVFYMAITRKIFKSHLKSRKNSISVKRKSSRNIFSIVL AFVACFAPYHVARIPYTKSQTEGHYSCQAKETLLYTKEFTLLLSAANVCLDPISISSYAS RLEKS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-LC3B Antibody (pT12)
F48560-0.08ML 0.08 mL

Phospho-LC3B Antibody (pT12)

Sign In for Pricing
View Details
1,2,3,4,5,6-Benzenehexamine Trihydrochloride
TRC-B189905-50MG 50 mg

1,2,3,4,5,6-Benzenehexamine Trihydrochloride

Sign In for Pricing
View Details
2-Chlorobenzonitrile
TRC-C367330-50G 50 g

2-Chlorobenzonitrile

Sign In for Pricing
View Details
Mini Sample Mouse NGF (Nerve growth factor) ELISA Kit
E-MSEL-M0056-01 24 Tests

Mini Sample Mouse NGF (Nerve growth factor) ELISA Kit

Sign In for Pricing
View Details
Mini Sample Mouse NGF (Nerve growth factor) ELISA Kit
E-MSEL-M0056-02 48 Tests

Mini Sample Mouse NGF (Nerve growth factor) ELISA Kit

Sign In for Pricing
View Details
Mini Sample Mouse NGF (Nerve growth factor) ELISA Kit
E-MSEL-M0056-03 96 Tests

Mini Sample Mouse NGF (Nerve growth factor) ELISA Kit

Sign In for Pricing
View Details