Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Heme A synthase (ctaA)

This Recombinant Heme A synthase (ctaA) spans the amino acid sequence from region 1-306.

Product Specifications

Product Name Alternative

Heme A synthase, HAS, EC= 1.3.-.-, Cytochrome aa3-controlling protein

UniProt

Q67L43

Expression Region

1-306

Origin

Symbiobacterium thermophilum

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKALRAVSLANTAVMLLAVLWGAWVTSSDSGDGCGASWPLCKGTFMPDWDYAAIVEFGHR VVSALAGLLSVAVLVWVARVRPSETRLKRLAFGTFFFVVLQGGLGAAAVLRPQPDLVMAL HFGFSLLCFTFALLVTVALGQGERAAFQRPDVSAQPVAPGLRTQIWGLAVYTYLVVYLGA YVRHLGASMACTGWPLCNGELIPPLYGPVGANFAHRLGAALAVVLVLRLWWTARRLTERD DLRRGAAWALALMAAQVASGALFPLGYLNLLTQLLHTGLITGFWGVLSYLCYLTLPVGRE TVAVSA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-EGFR (Tyr1197) Rabbit Polyclonal Antibody (BF405)
orb2412187 100 µL

Phospho-EGFR (Tyr1197) Rabbit Polyclonal Antibody (BF405)

Sign In for Pricing
View Details
Phospho-Tau (Thr231) Monoclonal Antibody, RBITC Conjugated
bsm-25325M-RBITC 100 µL

Phospho-Tau (Thr231) Monoclonal Antibody, RBITC Conjugated

Sign In for Pricing
View Details
Cyclin D (MaxLight 490) discontinued
C8454-05-ML490 100 µL

Cyclin D (MaxLight 490) discontinued

Sign In for Pricing
View Details
Lentiviral mouse Stk16 shRNA (UAS) - Lentiviral mouse Stk16 shRNA (UAS, iRFP) plasmid
GTR15158896 1 Vial

Lentiviral mouse Stk16 shRNA (UAS) - Lentiviral mouse Stk16 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
AKT3 Protein (N-GST, Human)
P513090 100 µg

AKT3 Protein (N-GST, Human)

Sign In for Pricing
View Details
PHACTR3 Protein Vector (Mouse) (pPM-C-His)
PV215573 500 ng

PHACTR3 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details