Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Heme A synthase (ctaA)

This Recombinant Heme A synthase (ctaA) spans the amino acid sequence from region 1-306.

Product Specifications

Product Name Alternative

Heme A synthase, HAS, EC= 1.3.-.-, Cytochrome aa3-controlling protein

UniProt

Q67L43

Expression Region

1-306

Origin

Symbiobacterium thermophilum

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKALRAVSLANTAVMLLAVLWGAWVTSSDSGDGCGASWPLCKGTFMPDWDYAAIVEFGHR VVSALAGLLSVAVLVWVARVRPSETRLKRLAFGTFFFVVLQGGLGAAAVLRPQPDLVMAL HFGFSLLCFTFALLVTVALGQGERAAFQRPDVSAQPVAPGLRTQIWGLAVYTYLVVYLGA YVRHLGASMACTGWPLCNGELIPPLYGPVGANFAHRLGAALAVVLVLRLWWTARRLTERD DLRRGAAWALALMAAQVASGALFPLGYLNLLTQLLHTGLITGFWGVLSYLCYLTLPVGRE TVAVSA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse AP13 ELISA Kit
E044508 1 Each

Mouse AP13 ELISA Kit

Sign In for Pricing
View Details
LRRC6, ID (LRRC6, LRTP, TSLRP, Protein TILB homolog, Leucine-rich repeat-containing protein 6, Leucine-rich testis-specific protein, Testis-specific leucine-rich repeat protein) (Azide free) (HRP) discontinued
037968-HRP 200 µL

LRRC6, ID (LRRC6, LRTP, TSLRP, Protein TILB homolog, Leucine-rich repeat-containing protein 6, Leucine-rich testis-specific protein, Testis-specific leucine-rich repeat protein) (Azide free) (HRP) discontinued

Sign In for Pricing
View Details
Anti-Activin Receptor Type IA (ACVR1) Antibody (Center R147)
A00798-2-80ul 80 µL

Anti-Activin Receptor Type IA (ACVR1) Antibody (Center R147)

Sign In for Pricing
View Details
Recombinant Human Centromere protein Q (CENPQ)
MBS1358285-01 0.02 mg (E-Coli)

Recombinant Human Centromere protein Q (CENPQ)

Sign In for Pricing
View Details
Recombinant Human Centromere protein Q (CENPQ)
MBS1358285-02 0.02 mg (Yeast)

Recombinant Human Centromere protein Q (CENPQ)

Sign In for Pricing
View Details
Recombinant Human Centromere protein Q (CENPQ)
MBS1358285-03 0.1 mg (E-Coli)

Recombinant Human Centromere protein Q (CENPQ)

Sign In for Pricing
View Details