Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Heme A synthase (ctaA)

This Recombinant Heme A synthase (ctaA) spans the amino acid sequence from region 1-306.

Product Specifications

Product Name Alternative

Heme A synthase, HAS, EC= 1.3.-.-, Cytochrome aa3-controlling protein

UniProt

Q67L43

Expression Region

1-306

Origin

Symbiobacterium thermophilum

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKALRAVSLANTAVMLLAVLWGAWVTSSDSGDGCGASWPLCKGTFMPDWDYAAIVEFGHR VVSALAGLLSVAVLVWVARVRPSETRLKRLAFGTFFFVVLQGGLGAAAVLRPQPDLVMAL HFGFSLLCFTFALLVTVALGQGERAAFQRPDVSAQPVAPGLRTQIWGLAVYTYLVVYLGA YVRHLGASMACTGWPLCNGELIPPLYGPVGANFAHRLGAALAVVLVLRLWWTARRLTERD DLRRGAAWALALMAAQVASGALFPLGYLNLLTQLLHTGLITGFWGVLSYLCYLTLPVGRE TVAVSA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RBM11 Antibody
MBS1493032-01 0.05 mg

RBM11 Antibody

Sign In for Pricing
View Details
RBM11 Antibody
MBS1493032-02 0.1 mg

RBM11 Antibody

Sign In for Pricing
View Details
RBM11 Antibody
MBS1493032-03 5x 0.1 mg

RBM11 Antibody

Sign In for Pricing
View Details
DCDC2C 3'UTR GFP Stable Cell Line
TU055614 1.0 mL

DCDC2C 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
HAX1 Protein Vector (Mouse) (pPM-C-HA)
PV187988 500 ng

HAX1 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
SMTNL1, ID (SMTNL1, Smoothelin-like protein 1) (MaxLight 550) discontinued
042062-ML550 100 µL

SMTNL1, ID (SMTNL1, Smoothelin-like protein 1) (MaxLight 550) discontinued

Sign In for Pricing
View Details