Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pan troglodytes Taste receptor type 2 member 10 (TAS2R10)

This Recombinant Pan troglodytes Taste receptor type 2 member 10 (TAS2R10) spans the amino acid sequence from region 1-307.

Product Specifications

Product Name Alternative

Taste receptor type 2 member 10, T2R10

UniProt

Q646B5

Expression Region

1-307

Origin

Pan troglodytes (Chimpanzee)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLRVVEGIFIFVVISESVFGVLGNGFIGLVNCIDCAKNKLSTIGFILTGLAISRIFLIWI IITDGFIQIFSPNIYASSNLIEYISYFWVIGNQSSMWFATSLSIFYFLKIANFSNYIFLW LKSRTNMVLPFMIVFLLISSLLNFAYIAKILNDYKMKNDTVWDLNMYKSEYFIKQILLNL GVIFFFTLSLITCVLLIISLWRHNRQMQSNVTGLRDSNTEAHVKAMKVLISFIILFILYF IGMAIEISYFTVRENKLLLMFGMTTTAIYPWGHSFILILGNSKLKQASLRVLQQLKCCEK RKNLRVT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD44 Standard (DF1485), CF594 conjugate, 0.1mg/mL
BNC941037-100 1x 100 µL

CD44 Standard (DF1485), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD4 (EDU-2), CF647 conjugate, 0.1mg/mL
BNC470345-500 1x 500 µL

CD4 (EDU-2), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD53 (161-2), CF405S conjugate, 0.1mg/mL
BNC040324-100 1x 100 µL

CD53 (161-2), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 / ICAM3 (CG106), CF594 conjugate, 0.1mg/mL
BNC942216-500 1x 500 µL

CD50 / ICAM3 (CG106), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ferritin, Light Chain (FTL) (Microglia Marker) (FTL/2338R), CF405S conjugate, 0.1mg/mL
BNC042338-500 1x 500 µL

Ferritin, Light Chain (FTL) (Microglia Marker) (FTL/2338R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD59 (heavy chain of Protectin) (MACIF/629), CF647 conjugate, 0.1mg/mL
BNC470629-100 1x 100 µL

CD59 (heavy chain of Protectin) (MACIF/629), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details