Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Papio hamadryas Taste receptor type 2 member 41 (TAS2R41)

This Recombinant Papio hamadryas Taste receptor type 2 member 41 (TAS2R41) spans the amino acid sequence from region 1-307.

Product Specifications

Product Name Alternative

Taste receptor type 2 member 41, T2R41

UniProt

Q646F3

Expression Region

1-307

Origin

Papio hamadryas (Hamadryas baboon)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQAALRAFFMLLFSLLSLLGIAANGFIVLVLGREWLRYGRLLPLDMILLSLGAFRFYLQL VGMGHNFYHSAHVVERSGVLTQQFFHLHWHFLNSVTFWFCSWLSVLFCVKIANITHPTFL WLKWRFPGWVPWLLLGSVLISFIIALLLFWVNYSAYQQFLIRTFSGNMTYEWNAMTEIYY FPFAQLVIWSIPCSVFLVSIXLLINSLRRHTWRMQHNSHSLQDPSTQAHTRALKFLISFL ILYVLSFLSLIIDGTKFISMQNDFYWPWQIAVYLSVSVHPFILIFNNLKLQSVFWQLLLL ARGFWVA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD104 (UM-A9), CF594 conjugate, 0.1mg/mL
BNC940449-500 1x 500 µL

CD104 (UM-A9), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC2 (CCP58), CF740 conjugate, 0.1mg/mL
BNC740032-500 1x 500 µL

MUC2 (CCP58), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytochrome C (CTC05), CF568 conjugate, 0.1mg/mL
BNC680887-500 1x 500 µL

Cytochrome C (CTC05), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP60 (GROEL/730), CF594 conjugate, 0.1mg/mL
BNC940730-100 1x 100 µL

HSP60 (GROEL/730), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 18 (DA7), CF568 conjugate, 0.1mg/mL
BNC680198-500 1x 500 µL

Cytokeratin 18 (DA7), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CFTR (Cystic Fibrosis Transmembrane Conductance Regulator) (CFTR/1775R), CF594 conjugate, 0.1mg/mL
BNC941775-100 1x 100 µL

CFTR (Cystic Fibrosis Transmembrane Conductance Regulator) (CFTR/1775R), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details