Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 4N2 (OR4N2)

This Recombinant Human Olfactory receptor 4N2 (OR4N2) spans the amino acid sequence from region 1-307.

Product Specifications

Product Name Alternative

Olfactory receptor 4N2, Olfactory receptor OR14-13, Olfactory receptor OR14-8

UniProt

Q8NGD1

Expression Region

1-307

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MESENRTVIREFILLGLTQSQDIQLLVFVLVLIFYFIILPGNFLIIFTIKSDPGLTAPLY FFLGNLAFLDASYSFIVAPRMLVDFLSAKKIISYRGCITQLFFLHFLGGGEGLLLVVMAF DRYIAICRPLHYPTVMNPRTCYAMMLALWLGGFVHSIIQVVLILRLPFCGPNQLDNFFCD VPQVIKLACTDTFVVELLMVFNSGLMTLLCFLGLLASYAVILCRIRGSSSEAKNKAMSTC ITHIIVIFFMFGPGIFIYTRPFRAFPADKVVSLFHTVIFPLLNPVIYTLRNQEVKASMKK VFNKHIA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TOP3B Human Gene Knockout Kit (CRISPR)
KN423204 1 Kit

TOP3B Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Glyceryl Trinonadecanoate
TRC-G601600-50MG 50 mg

Glyceryl Trinonadecanoate

Sign In for Pricing
View Details
MART-1 / Melan-A (MLANA/788), 0.2mg/mL
BNUB0788-100 1x 100 µL

MART-1 / Melan-A (MLANA/788), 0.2mg/mL

Sign In for Pricing
View Details
Frozen Tissue Sections, Ovary
CS501905 5x 5 µm

Frozen Tissue Sections, Ovary

Sign In for Pricing
View Details
CDX2 (NM_001265) Human Over-expression Lysate
LC420044 20 µg

CDX2 (NM_001265) Human Over-expression Lysate

Sign In for Pricing
View Details
4-Chlorobenzoic anhydride
TRC-C427630-500MG 500 mg

4-Chlorobenzoic anhydride

Sign In for Pricing
View Details